DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and vanin-like

DIOPT Version :8

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_572297.1 Gene:vanin-like / 31551 FlyBaseID:FBgn0040069 Length:558 Species:Drosophila melanogaster

Alignment Length:539 Identity:392/539 - (72%)
Similarity:455/539 - (84%) Gaps:25/539 - (4%)


  Fly     1 MAKNYWGFFLFCLALGLMLNLSQQASLFKRDFYTAGVVEFEPS----NELSDNLAGYLEIIQSQN 61
            |:..:|...:..|.||||..:||||:|.:.|:||||||||:.|    :..||:||||:|||.|:|
  Fly     1 MSNTWWWLSVVLLILGLMPGMSQQAALAESDYYTAGVVEFKQSILSLSAWSDSLAGYVEIINSEN 65

  Fly    62 ATSTDIIVFPESTLNSAGSTTFVPNPEDQINPCLSDPNATYYEEFLVTLSCAARNASKYIVINLT 126
            |::||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 ASATDIIVFPESTLNSAGSTTFVPNPEDQINPCLSDPNATYYEEFLVTLSCAARNASKYIVINLT 130

  Fly   127 EKQKCEDIPEDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHLYGEPKNSTFLPELSTFETDFG 191
            |||||||||||||||||||||||||||||||||||||||||||||||.|||||||||.|||||||
  Fly   131 EKQKCEDIPEDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHLYGEAKNSTFLPELITFETDFG 195

  Fly   192 VTFGHFICFDILFYTPAHQLIVEQGITDFVYPAMWFSQLPFLTVNGIFSSKAVQIQLGWSYANNV 256
            |||||||||||||||||||||||||||||||||||||||||||        |||.|.||:|||:|
  Fly   196 VTFGHFICFDILFYTPAHQLIVEQGITDFVYPAMWFSQLPFLT--------AVQTQQGWAYANDV 252

  Fly   257 NLLAAGASDPIVGNSGSGIYHGRSGSLRSVMRQESGERSIYVARVPKY--------RAKRRMKRD 313
            ||||:|||.|.:|||||||||||||:|.|||||:||||:||||:||||        ||||.::..
  Fly   253 NLLASGASRPSIGNSGSGIYHGRSGTLTSVMRQDSGERAIYVAQVPKYTRSRSLKKRAKRSLQEI 317

  Fly   314 LKRQVATSSSFNIKRDYLENFTSEELKIDAGKIGNLSQNLCHGGFCCHFDLAWRSLGKPSRNTSH 378
            ..||||:||||.:||||:||:.||.||:|.|..|.:::.:|.|.|||:||:||||||..:.|.|:
  Fly   318 QTRQVASSSSFYMKRDYVENYESELLKLDEGTSGAINRTICQGSFCCNFDIAWRSLGTATENGSY 382

  Fly   379 YSYRVGIYEGWRNEKRLDVNYIRNCGVFTCSGNSIDDCGQLLP---DIQRPLVTFTHVEIRVTYP 440
            ||||:|.|:|||||..:|.||||||.:|||||:||||||:|||   ::|:..||||.:.|.||||
  Fly   383 YSYRLGTYDGWRNENNVDANYIRNCALFTCSGDSIDDCGKLLPTEGELQQSRVTFTRLAIGVTYP 447

  Fly   441 QSREFLLFPDTLLDNLLPLEPKQFEWSQKRISEESH--QVRFALRKSLEVKHLLTFGIYGNYYNN 503
            :|||||||||||.|:||||||.||||||::.:|:|:  :|||||:::.|:.:|||||||||||:|
  Fly   448 ESREFLLFPDTLQDSLLPLEPSQFEWSQRKPTEDSYVQEVRFALKETQELSNLLTFGIYGNYYDN 512

  Fly   504 ECTFGVGTAEEQLECGYKN 522
            ||||||||.||||.|||::
  Fly   513 ECTFGVGTEEEQLACGYRS 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 251/307 (82%)
vanin-likeNP_572297.1 biotinidase_like 33..304 CDD:143591 238/278 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25289493
eggNOG 1 0.900 E1_COG0388
Homologene 1 1.000 H37255
Inparanoid 1 1.050 163 1.000 Inparanoid score I4143
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1276751at2759
OrthoFinder 1 1.000 FOG0000996
orthoMCL 1 0.900 OOG5_137250
Panther 1 1.100 P PTHR10609
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.