DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and Nit1

DIOPT Version :10

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_036179.1 Gene:Nit1 / 27045 MGIID:1350916 Length:323 Species:Mus musculus


Alignment Length:227 Identity:47/227 - (20%)
Similarity:79/227 - (34%) Gaps:72/227 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ESTLNSAGSTTFVPNPEDQINPCLSDPNATYYEEFLVTLSC----------AARNASKYIVINLT 126
            |..|.:....|..||.::....|     |...:|.....:|          .|||.::.::::  
Mouse    41 ELPLVAVCQVTSTPNKQENFKTC-----AELVQEAARLGACLAFLPEAFDFIARNPAETLLLS-- 98

  Fly   127 EKQKCEDIPED--------TRPCA---------------SNGLNVFNTNVVFDRQGVVVSRYRKV 168
                 |.:..|        .|.|.               .....::|.:|:.:.:|.||:.|||.
Mouse    99 -----EPLNGDLLGQYSQLARECGIWLSLGGFHERGQDWEQNQKIYNCHVLLNSKGSVVASYRKT 158

  Fly   169 HL-------YGEPKNSTFLPELSTFE----TDFGVTFGHFICFDILFYTPAHQL-IVEQGITDFV 221
            ||       .|..:.|.:.....|.|    |..| ..|..||:|:.|  |...| :.:.|.....
Mouse   159 HLCDVEIPGQGPMRESNYTKPGGTLEPPVKTPAG-KVGLAICYDMRF--PELSLKLAQAGAEILT 220

  Fly   222 YPAMWFSQLPFLTVNG------IFSSKAVQIQ 247
            ||:      .|.:|.|      :..::|::.|
Mouse   221 YPS------AFGSVTGPAHWEVLLRARAIESQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 47/227 (21%)
Vanin_C 324..503 CDD:465946
Nit1NP_036179.1 nit 44..311 CDD:143596 46/224 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.