DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and Vnn3

DIOPT Version :8

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_036109.3 Gene:Vnn3 / 26464 MGIID:1347055 Length:500 Species:Mus musculus

Alignment Length:556 Identity:145/557 (26%)
Similarity:218/557 (39%) Gaps:133/557 (24%)


  Fly     6 W--GFFLFCLALGLMLNLSQQASLFKRDFYTAGVVEFE---PS---------------NELSDNL 50
            |  .|..|..|:|.|            |.:.|.|.|..   |:               |:..|.|
Mouse     9 WAVSFVFFAQAVGSM------------DTFIAAVYEHAVILPNKTESPVSTEEALLLINKNIDIL 61

  Fly    51 AGYLEIIQSQNATSTDIIVFPESTLNS---AGSTTF-----VPNPEDQINPCLSDPNATYYEEFL 107
            ...:::...|.|   .|||.||..:..   ...|.:     :|:||....|| .||....|....
Mouse    62 ESAIKLAARQGA---HIIVTPEDGIYGWIFTRETIYPYLEDIPDPEVNWIPC-RDPRRFGYTPVQ 122

  Fly   108 VTLSCAARNASKYIVINLTEKQKCEDIPEDTRP-CASNGLNVFNTNVVFDRQGVVVSRYRKVHLY 171
            ..|||.|:..|.||:.|:.:|:.|    ..|.| |..:|...:|||||||.:|.:.:||.|.:|:
Mouse   123 ERLSCLAKENSIYIMANIGDKKPC----NATDPHCPPDGRYQYNTNVVFDSKGRLTARYHKYNLF 183

  Fly   172 GEPKNSTFLP---ELSTFETDFGVTFGHFICFDILFYTPAHQLIVEQGITDFVYPAMWFSQLPFL 233
             ||:.....|   ||.||:|.|| .||.|.||||..|.||..::.:..:...:.|..|::.||.|
Mouse   184 -EPEIQFDFPKDSELVTFDTPFG-KFGIFTCFDIFSYDPAVVVVKDTQVDSVLLPTAWYNTLPLL 246

  Fly   234 TVNGIFSSKAVQIQLGWSYANNVNLLAAGASDPIVGNSGSGIYHGRSGSLRSV------MRQESG 292
            :        ||.....|:.|..||:|||...:..:..:|||||     |..:|      |..|||
Mouse   247 S--------AVPFHSVWARAMGVNVLAANTHNTSMHMTGSGIY-----SPEAVRVYHYDMETESG 298

  Fly   293 ERSIYVARVPKYRAKRRMKRDLKRQVATSSSFN-------IK-----------RDYLENFTSEEL 339
            :  :.::.:          |...||.||.:..|       :|           :.|.:.|:..:|
Mouse   299 Q--LLLSEL----------RSRPRQHATPAEVNWSAYARTVKPFSSGQADFPGKIYFDEFSFTKL 351

  Fly   340 KIDAGKIGNLSQNLCHGGFCCHFDLAWRSLGKPSRNTSHYSYRVGIYEGWRNEKRLDVNYIRNCG 404
               .|..||.:  :|....|||...      |.|.:.....|.:|.::|....:  ...|::.|.
Mouse   352 ---TGSAGNYT--VCQKDLCCHLTY------KMSESRMDEVYVLGAFDGLHTVE--GQYYLQICT 403

  Fly   405 VFTCSGNSIDDCGQLLPDIQRPLVTFTHVEIRVTYPQSREFLLFPDTLLD-NLLPLEPKQFEWSQ 468
            :..|...:...||:   .:......|....:..|:   |...:||..:|. :.|.||        
Mouse   404 LLKCQTTNSRTCGE---PVGSAFTKFEEFSLSGTF---RTKYVFPQIVLSGSQLALE-------- 454

  Fly   469 KRISEESHQVRFALRKSLEVKHLLTFGIYGNYYNNE 504
             |..|.|...|...|....:. :|...:||..:..:
Mouse   455 -RYYEVSRDGRLRSRGGAPLP-ILVMALYGRVFERD 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 101/350 (29%)
Vnn3NP_036109.3 biotinidase_like 26..329 CDD:143591 101/338 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25984394
eggNOG 1 0.900 E1_COG0388
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I4153
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1276751at2759
OrthoFinder 1 1.000 FOG0000996
OrthoInspector 1 1.000 T130941
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10609
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.860

Return to query results.
Submit another query.