DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and Btd

DIOPT Version :8

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_079571.1 Gene:Btd / 26363 MGIID:1347001 Length:529 Species:Mus musculus

Alignment Length:558 Identity:159/558 - (28%)
Similarity:228/558 - (40%) Gaps:109/558 - (19%)


  Fly     8 FFLFCLALGLMLNLSQQASLFKRDFYTAGVVEF---------------EPSNELSDNLAGYLEII 57
            |||.|.||.|.::.:.|... :.::|.|.|.|.               |....:..||..|.:.:
Mouse    20 FFLGCSALALGVSSASQEHR-EAEYYVAAVYEHPSVLSPNPLELVSRQEALELMKQNLDVYEQQV 83

  Fly    58 QSQNATSTDIIVFPESTLNSAGST--------TFVPNPE-DQINPCLSDPNATYYEEFLVTLSCA 113
            .:.......||||||..::....|        .|:|:|: .:.|||| :|......|.|..|||.
Mouse    84 MAAAQKGVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPKLVRWNPCL-EPFRFNDTEVLQRLSCM 147

  Fly   114 ARNASKYIVINLTEKQKCEDIPEDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHLYGE----- 173
            |.....::|.||..||.|  :..|. .|..:|...|||||||...|.:|.||||.:||.|     
Mouse   148 AIKGGMFLVANLGTKQPC--LSSDP-GCPQDGRYQFNTNVVFSDNGTLVDRYRKHNLYFEAAFDT 209

  Fly   174 PKNSTFLPELSTFETDFGVTFGHFICFDILFYTPAHQLIVEQGITDFVYPAMWFSQLPFLTVNGI 238
            |.|    .:|.||:|.|...||.|.||||||:.||.:|:.:..:...|||..|.:|||.|.    
Mouse   210 PAN----VDLITFDTPFAGKFGVFTCFDILFFDPAVRLLRDFEVKHIVYPTAWMNQLPLLA---- 266

  Fly   239 FSSKAVQIQLGWSYANNVNLLAAGASDPIVGNSGSGI--------YH------------------ 277
                |::||..::.|..||:|||....|.:|.:||||        ||                  
Mouse   267 ----AIEIQKAFATAFGVNVLAANIHHPTLGMTGSGIHTPLKSFWYHDMDDPKGHLIIAQVATNP 327

  Fly   278 -GRSGSLRSVMRQESGERS-IYVARVPKYRAKRRMK----RDLKRQVATSSSFNIKRDYLENFTS 336
             |.:|:..:....:...|. :.:.....|..|...:    ...|..|....:|:.:..| :||| 
Mouse   328 QGLTGTGNTTSEMDPSHRKFLKILSGDPYCEKDAQEVHCDEAAKWNVNVPPTFHSEMMY-DNFT- 390

  Fly   337 EELKIDAGKIGNLSQNLCHGGFCCHFDLAWRSLGKPSRNTSHYSYRVGIYEGWRNEKRLDVNYIR 401
              |....|..|:|  .:|....|||......:|.|.       .|.:|:::|.....  ...||:
Mouse   391 --LVPVWGTEGHL--QVCSNSLCCHLLYERPTLSKE-------LYALGVFDGLHTVH--GTYYIQ 442

  Fly   402 NCGVFTCSGNSIDDCGQLLPDIQRPLVTFTHVEIRVTYPQSREFLLFPDTLLDNLLPLEPKQFEW 466
            .|.:..|.|...|.|||.:.:.: .|..| |:     :.......:||..|...:....|.|..|
Mouse   443 TCALVKCGGLGFDTCGQEITEAE-GLFDF-HL-----WGNFSTLYIFPLFLTSGMTLDTPDQLGW 500

  Fly   467 SQKRISEESHQVRFALRKSLEVKHLLTFGIYGNYYNNE 504
                  |..|   :.|||......|:|..:||..|..:
Mouse   501 ------ENDH---YFLRKRGLSSGLVTAALYGRLYERK 529

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 106/356 (30%)
BtdNP_079571.1 biotinidase_like 44..347 CDD:143591 101/318 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25989446
eggNOG 1 0.900 E1_COG0388
Hieranoid 1 1.000
Homologene 1 1.000 H37255
Inparanoid 1 1.050 165 1.000 Inparanoid score I4153
Isobase 1 0.950 0.918296 Normalized mean entropy S7850
OMA 1 1.010
OrthoDB 1 1.010 D1276751at2759
OrthoFinder 1 1.000 FOG0000996
OrthoInspector 1 1.000 T130941
orthoMCL 1 0.900 OOG5_137250
Panther 1 1.100 O PTHR10609
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1413.720

Return to query results.
Submit another query.