DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and Upb1

DIOPT Version :10

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_598756.1 Gene:Upb1 / 103149 MGIID:2143535 Length:393 Species:Mus musculus


Alignment Length:173 Identity:38/173 - (21%)
Similarity:63/173 - (36%) Gaps:49/173 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EIIQSQNATSTDIIVFPES--------TLNSAGSTTFVPNPEDQINPCLSDPNATYYEEFLVTLS 111
            ||.:.......:||.|.|:        |......|.|..:.||.                |.|..
Mouse   102 EIAEVAAMCGVNIICFQEAWNMPFAFCTREKLPWTEFAESAEDG----------------LTTRF 150

  Fly   112 C--AARNASKYIVINLTEKQKCEDIPEDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHL--YG 172
            |  .|:..:..:|..:.|:.:            .:|..::||.||....|:|:.:.||.|:  .|
Mouse   151 CQKLAKKHNMVVVSPILERDR------------EHGGVLWNTAVVISNSGLVMGKTRKNHIPRVG 203

  Fly   173 EPKNSTFLPELS----TFETDFG-----VTFGHFICFDILFYT 206
            :...||:..|.:    .|:|.||     :.:|.....:.|.|:
Mouse   204 DFNESTYYMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 38/173 (22%)
Vanin_C 324..503 CDD:465946
Upb1NP_598756.1 ML_beta-AS 9..371 CDD:143611 38/173 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.