DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and Upb1

DIOPT Version :8

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_598756.1 Gene:Upb1 / 103149 MGIID:2143535 Length:393 Species:Mus musculus

Alignment Length:173 Identity:38/173 - (21%)
Similarity:63/173 - (36%) Gaps:49/173 - (28%)


  Fly    55 EIIQSQNATSTDIIVFPES--------TLNSAGSTTFVPNPEDQINPCLSDPNATYYEEFLVTLS 111
            ||.:.......:||.|.|:        |......|.|..:.||.                |.|..
Mouse   102 EIAEVAAMCGVNIICFQEAWNMPFAFCTREKLPWTEFAESAEDG----------------LTTRF 150

  Fly   112 C--AARNASKYIVINLTEKQKCEDIPEDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHL--YG 172
            |  .|:..:..:|..:.|:.:            .:|..::||.||....|:|:.:.||.|:  .|
Mouse   151 CQKLAKKHNMVVVSPILERDR------------EHGGVLWNTAVVISNSGLVMGKTRKNHIPRVG 203

  Fly   173 EPKNSTFLPELS----TFETDFG-----VTFGHFICFDILFYT 206
            :...||:..|.:    .|:|.||     :.:|.....:.|.|:
Mouse   204 DFNESTYYMEGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYS 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 38/173 (22%)
Upb1NP_598756.1 PLN00202 6..392 CDD:177792 38/173 (22%)
ML_beta-AS 9..371 CDD:143611 38/173 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.