DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbm13 and MAK16

DIOPT Version :8

Sequence 1:NP_001285026.1 Gene:Rbm13 / 31818 FlyBaseID:FBgn0030067 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_009377.2 Gene:MAK16 / 851208 SGDID:S000000023 Length:306 Species:Saccharomyces cerevisiae

Alignment Length:341 Identity:148/341 - (43%)
Similarity:210/341 - (61%) Gaps:45/341 - (13%)


  Fly     4 DDVVWSIINKSFCSHKVKT-DTRTFCRHEYNLTGLCTRRTCPLANSQYATVREEKGIIYLFIKTA 67
            |::||.:||:|||||::|. :.:.|||:|||:||||||::||||||:||||:.:.|.:||::||.
Yeast     3 DEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKLYLYMKTP 67

  Fly    68 ERAHMPSKLWERIKLSRNFEKAIEQINENLVFWPKYMIAKNKQRFLKITQYLIRMRRLKLR-RQK 131
            ||||.|:|||||||||:|:.||::||:|:|:.|.|:...|.||||.|:||.:|..|||.|| .::
Yeast    68 ERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMITERRLALREEER 132

  Fly   132 LIVPLSTKIERREARREEKALVAAKIDNHIEKALMDRLKNGTYRD-IYNFSQTAFNKAL-EAERV 194
            ..|.::.|::|||..||.||||||||:..|||.||||||:|.|.| ..|..:..:.|.: :.|..
Yeast   133 HYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAYGDKPLNVDEKVWKKIMGQMEEE 197

  Fly   195 DEDDEEELDDEDENEEQLEREMEVDGDDSREAEEVQRSLLDEEFVEADTDDEEEDDDDDDDDDED 259
            :..||||  |.||.||..:.|:|...||.           :.|:|  |.||.|:...|.|.:...
Yeast   198 NSQDEEE--DWDEEEESDDGEVEYVADDG-----------EGEYV--DVDDLEKWLADSDREASS 247

  Fly   260 DYDSDSGKREEVEVGSDFEESDEDDDADADDIEETKVPAKKTASKAKKDKKSPAGNSRRSRSKPK 324
            ..:|               |||.:.::|:|..||.|       :.||:.||..:..::|    ||
Yeast   248 ASES---------------ESDSESESDSDSDEENK-------NSAKRRKKGTSAKTKR----PK 286

  Fly   325 LQLEYEYEVEKEAQRQ 340
            :::|||.|.|.:...|
Yeast   287 VEIEYEEEHEVQNAEQ 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbm13NP_001285026.1 PLN00040 1..225 CDD:215038 118/224 (53%)
Ribosomal_L28e 6..115 CDD:280030 65/109 (60%)
Mak16 139..241 CDD:282698 44/103 (43%)
MAK16NP_009377.2 MAK16 1..306 CDD:227458 148/341 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C212735437
eggNOG 1 0.900 E1_COG5129
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 249 1.000 Inparanoid score I659
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004137
OrthoInspector 1 1.000 T1136915
orthoMCL 1 0.900 OOG5_128004
Panther 1 1.100 LDO PTHR23405
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R678
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.