DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbm13 and AT1G23280

DIOPT Version :9

Sequence 1:NP_001285026.1 Gene:Rbm13 / 31818 FlyBaseID:FBgn0030067 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_173742.1 Gene:AT1G23280 / 838937 AraportID:AT1G23280 Length:303 Species:Arabidopsis thaliana


Alignment Length:344 Identity:143/344 - (41%)
Similarity:209/344 - (60%) Gaps:47/344 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQHDDVVWSIINKSFCSHKVKTDTRTFCRHEYNLTGLCTRRTCPLANSQYATVREEKGIIYLFIK 65
            ||||:|:|.:|....||:..|.:|..|||::||:||:|.|.:||||||:|||:|:..|:.||::|
plant     1 MQHDEVIWQVIRHKHCSYMAKIETGIFCRNQYNVTGICNRSSCPLANSRYATIRDHDGVFYLYMK 65

  Fly    66 TAERAHMPSKLWERIKLSRNFEKAIEQINENLVFWPKYMIAKNKQRFLKITQYLIRMRRLKLRRQ 130
            |.||||||:|||||:||..|:|||:|.|:::|::|||.:..|.|||..|:||..||||:|.|:.:
plant    66 TIERAHMPNKLWERVKLPVNYEKALEMIDKHLLYWPKLLQHKVKQRLTKMTQMRIRMRKLALKTR 130

  Fly   131 KLIVPLSTKIERREARREEKALVAAKIDNHIEKALMDRLKNGTY-RDIYNFSQTAFNKALEAERV 194
            :::|....:..:||:||||||:.||::|..||..||:|||.|.| .:|||.|.:.|||.|     
plant   131 EVVVTTPRRQIKRESRREEKAIKAAQLDKAIETELMERLKKGIYPTEIYNLSDSVFNKLL----- 190

  Fly   195 DEDDEEELDDEDENEEQLEREME-VDGDDSREAEEVQRSLLDEEFVEADTDDEEEDDDDDDDDDE 258
              |.|.|.:||.|.||:.|..:| |:|||..||||                          ::|.
plant   191 --DREIETNDEVEKEEEEEGVIEYVEGDDELEAEE--------------------------EEDM 227

  Fly   259 DDYDSDSGKREEVEVGSDFEESDEDDDADADDIEETKVPAKKTASKAKKDKKSPAGNSRRSRSKP 323
            :|:.....|...:| |.|.:..||||    ||.||..|..||..:..|.|      ::.:::.||
plant   228 EDFSGLPSKESYLE-GDDHDSDDEDD----DDAEEQVVIHKKGRALKKSD------DNGKAKKKP 281

  Fly   324 KLQLEYEYEVEKEAQRQMR 342
            ::.:|.|.| :.:.:|.::
plant   282 RVVVEVEQE-DADTRRSLK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbm13NP_001285026.1 PLN00040 1..225 CDD:215038 114/225 (51%)
Ribosomal_L28e 6..115 CDD:280030 58/108 (54%)
Mak16 139..241 CDD:282698 46/103 (45%)
AT1G23280NP_173742.1 PLN00040 1..300 CDD:215038 143/344 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 148 1.000 Domainoid score I1443
eggNOG 1 0.900 - - E1_COG5129
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 255 1.000 Inparanoid score I1002
OMA 1 1.010 - - QHG54003
OrthoDB 1 1.010 - - D1394336at2759
OrthoFinder 1 1.000 - - FOG0004909
OrthoInspector 1 1.000 - - oto3262
orthoMCL 1 0.900 - - OOG6_102084
Panther 1 1.100 - - LDO PTHR23405
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3461
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.