DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbm13 and Mak16

DIOPT Version :8

Sequence 1:NP_001285026.1 Gene:Rbm13 / 31818 FlyBaseID:FBgn0030067 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_080729.1 Gene:Mak16 / 67920 MGIID:1915170 Length:296 Species:Mus musculus

Alignment Length:340 Identity:165/341 (48%)
Similarity:226/341 (66%) Gaps:50/341 (15%)


  Fly     1 MQHDDVVWSII-NKSFCSHKVKTDTRTFCRHEYNLTGLCTRRTCPLANSQYATVREEKGIIYLFI 64
            ||.|||:|:.: ||.|||.|::|.|:.|||:||:|||||.|.:||||||||||::||||..||::
Mouse     1 MQSDDVIWNTLGNKQFCSFKIRTKTQGFCRNEYSLTGLCNRSSCPLANSQYATIKEEKGQCYLYM 65

  Fly    65 KTAERAHMPSKLWERIKLSRNFEKAIEQINENLVFWPKYMIAKNKQRFLKITQYLIRMRRLKLRR 129
            |..|||..|.:||||::||:|:|||:|||:|||::||:::..|.||||.||||||||:|:|.|:|
Mouse    66 KVIERAAFPRRLWERVRLSKNYEKALEQIDENLIYWPRFIRHKCKQRFTKITQYLIRIRKLTLKR 130

  Fly   130 QKLIVPLSTKIERREARREEKALVAAKIDNHIEKALMDRLKNGTYRDIYNFSQTAFNKALEAERV 194
            |:.:||||.|:||||.|||||||:||::||.|||.|::|||..||.|||||...||:||||.:..
Mouse   131 QRKLVPLSKKVERREKRREEKALIAAQLDNAIEKELLERLKQDTYGDIYNFPIHAFDKALEKQEA 195

  Fly   195 DEDDEEELDDEDENEEQLEREMEVDGDDSREAEEVQRSLLDEEFVEADTDDEEEDDDDDDDDDED 259
            :.|.|:|.::|||:||                |:|.:    .||||   |:|.|:.|..|.:|.|
Mouse   196 ESDSEDEEEEEDEDEE----------------EDVGK----REFVE---DEEVEESDLSDFEDMD 237

  Fly   260 DYDSDSGKREEVEVGSDFEESDEDDDADADDIEETKVPAKKTASKAKKDKKSP-AGNSRRSRSKP 323
            ..::||             |.|:||::..|:          .|.|||...|:| .|..|:.|:  
Mouse   238 KLNTDS-------------EEDQDDESSNDE----------EAHKAKHKGKAPLKGPLRKKRA-- 277

  Fly   324 KLQLEYEYEVEKEAQ 338
            .:::|||.|.|..|:
Mouse   278 YVEIEYEQETEPMAK 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbm13NP_001285026.1 PLN00040 1..225 CDD:215038 130/225 (58%)
Ribosomal_L28e 6..115 CDD:280030 66/110 (60%)
Mak16 139..241 CDD:282698 50/102 (49%)
Mak16NP_080729.1 MAK16 2..288 CDD:227458 162/334 (49%)
Ribosomal_L28e 6..116 CDD:280030 66/110 (60%)
Mak16 148..>194 CDD:282698 30/46 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C212729960
eggNOG 1 0.900 E1_COG5129
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 302 1.000 Inparanoid score I2649
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004137
OrthoInspector 1 1.000 T1085550
orthoMCL 1 0.900 OOG5_128004
Panther 1 1.100 LDO PTHR23405
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R678
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.