DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbm13 and dom

DIOPT Version :9

Sequence 1:NP_001285026.1 Gene:Rbm13 / 31818 FlyBaseID:FBgn0030067 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001286676.1 Gene:dom / 45655 FlyBaseID:FBgn0020306 Length:3233 Species:Drosophila melanogaster


Alignment Length:395 Identity:81/395 - (20%)
Similarity:135/395 - (34%) Gaps:102/395 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SHKVKTDTRTFCR-HEYNLTGLCTRRTCPLANSQYATVREEKGIIYLFIKTAERAHMPSKLWERI 80
            |.|.|.:.....| .|....||.|.|..|....                .:..:||....|.|.:
  Fly   515 SFKAKQEVYVMQRISELQREGLWTERRLPKLQE----------------PSRPKAHWDYLLEEMV 563

  Fly    81 KLSRNFEKAIEQINENLVFWPK-------YMIAKNKQRFLKITQYLIRMRRLKLRRQKLIVPLST 138
            .|:.:|.:..:        |.|       .|:.|..|......|...:.:.|:|:|....:....
  Fly   564 WLAADFAQERK--------WKKNAAKKCAKMVQKYFQDKATAAQRAEKAQELQLKRVASFIAREV 620

  Fly   139 K---------IE-RREARREEKALVAAKIDNHIE------KALMDRLKNGTYRDI-----YNFSQ 182
            |         :| :.:.:.|||...|  :|.|:.      :....:|..|..:.:     .|.|:
  Fly   621 KSFWSNVEKLVEYKHQTKIEEKRKQA--LDQHLSFIVDQTEKFSQQLVEGMNKSVADTPSLNSSR 683

  Fly   183 TAFNKA-----LEAERVDEDDEE-----ELDDEDENEE--QLEREMEVDGDD------------- 222
            ....|.     ...|...|||||     |.|..|..||  .|.:|.|:|.||             
  Fly   684 LTSPKRESDDDFRPESGSEDDEETIAKAEEDAADVKEEVTALAKESEMDFDDFLNDLPPGYLENR 748

  Fly   223 SREAEEVQRSLLDEEFVEADTDDEEEDDDDDDDDDEDDYDSDSGKREEVEVGSDFEESDEDDDAD 287
            .:..:|.|.|.:..|..: |:||.|.:..:..||||:.........:|::...:.:|.:.|:|..
  Fly   749 DKLMKEEQSSAIKTETPD-DSDDSEFEAKEASDDDENTISKQEEAEQEIDHKKEIDELEADNDLS 812

  Fly   288 ADDI------EETKVPAKK---------------TASKAKKDKKSPAGNSRRSRSKPKLQLEYEY 331
            .:.:      |:...|.::               ||..:.::.:..|.......|..|...:.|.
  Fly   813 VEQLLAKYKSEQPPSPKRRKLAPRDPELDSDDDSTAVDSTEESEDAATEDEEDLSTVKTDTDMEE 877

  Fly   332 EVEKE 336
            :.|:|
  Fly   878 QDEQE 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbm13NP_001285026.1 PLN00040 1..225 CDD:215038 55/261 (21%)
Ribosomal_L28e 6..115 CDD:280030 21/105 (20%)
Mak16 139..241 CDD:282698 34/147 (23%)
domNP_001286676.1 HSA 543..614 CDD:214727 16/94 (17%)
ASF1_hist_chap <674..831 CDD:304562 38/157 (24%)
FAM176 <824..>868 CDD:291517 4/43 (9%)
SNF2_N 952..1238 CDD:278600
DEXDc 969..1108 CDD:238005
Helicase_C 1692..1806 CDD:278689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.