DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbm13 and mak16

DIOPT Version :8

Sequence 1:NP_001285026.1 Gene:Rbm13 / 31818 FlyBaseID:FBgn0030067 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_775346.2 Gene:mak16 / 192312 ZFINID:ZDB-GENE-020419-35 Length:305 Species:Danio rerio

Alignment Length:336 Identity:168/336 - (50%)
Similarity:233/336 - (69%) Gaps:41/336 - (12%)


  Fly     1 MQHDDVVWSII-NKSFCSHKVKTDTRTFCRHEYNLTGLCTRRTCPLANSQYATVREEKGIIYLFI 64
            ||||||:|.:| ||||||:||||.|:.|||:|||:||||.|.:||||||||||:|||||..:|::
Zfish     1 MQHDDVIWDLIGNKSFCSYKVKTKTQQFCRNEYNITGLCNRSSCPLANSQYATIREEKGQCFLYM 65

  Fly    65 KTAERAHMPSKLWERIKLSRNFEKAIEQINENLVFWPKYMIAKNKQRFLKITQYLIRMRRLKLRR 129
            |..|||..||::||::||.||:.||:|||:|||::||:::..|.|||..||||||||:|:|.|:|
Zfish    66 KVIERAAFPSRMWEKVKLDRNYAKALEQIDENLIYWPRFIRHKCKQRLTKITQYLIRIRKLTLKR 130

  Fly   130 QKLIVPLSTKIERREARREEKALVAAKIDNHIEKALMDRLKNGTYRDIYNFSQTAFNKALEAERV 194
            |:.:||||.|:||||.|||||||:||:::|.|||.|:||||.|||.|||||...||:||:|.:..
Zfish   131 QRKLVPLSRKVERREKRREEKALIAAQLENAIEKELLDRLKQGTYGDIYNFPINAFDKAMEKQDE 195

  Fly   195 DEDDEEELDDEDENEEQLEREMEVDGDDSREAEEVQRSLLDEEFVEADTDDEEEDDDDDDDDDED 259
            :.:.|||.::|:|:||:         ..:||      .:.::||.|:|..|.||.::..|..|| 
Zfish   196 ESESEEEEEEEEEDEEE---------SGTRE------FIAEDEFEESDLSDFEELNNLKDSSDE- 244

  Fly   260 DYDSDSGKREEVEVGSDFEESDEDDDADADDIEETKVPAKKTASKAKKDKKSP-AGNSRRSRSKP 323
                        ||.:: |||.|:.:.:::: ||.|       ||||...|:| .|.||:.|:  
Zfish   245 ------------EVNNE-EESSEESEEESEE-EEVK-------SKAKSKGKAPLKGPSRKKRA-- 286

  Fly   324 KLQLEYEYEVE 334
            .:::|||.|.|
Zfish   287 YVEIEYEQETE 297

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rbm13NP_001285026.1 PLN00040 1..225 CDD:215038 132/224 (59%)
Ribosomal_L28e 6..115 CDD:280030 67/109 (61%)
Mak16 139..241 CDD:282698 47/101 (47%)
mak16NP_775346.2 MAK16 2..297 CDD:227458 166/333 (50%)
Ribosomal_L28e 6..116 CDD:280030 67/109 (61%)
Mak16 152..234 CDD:282698 40/96 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C212729618
eggNOG 1 0.900 E1_COG5129
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 309 1.000 Inparanoid score I2552
OMA 1 1.010
OrthoDB 1 1.010 D1394336at2759
OrthoFinder 1 1.000 FOG0004137
OrthoInspector 1 1.000 T1054676
orthoMCL 1 0.900 OOG5_128004
Panther 1 1.100 LDO PTHR23405
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R678
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.