DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uros1 and UROS

DIOPT Version :8

Sequence 1:NP_001259362.1 Gene:Uros1 / 31817 FlyBaseID:FBgn0030066 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001310965.1 Gene:UROS / 7390 HGNCID:12592 Length:292 Species:Homo sapiens

Alignment Length:291 Identity:95/292 (33%)
Similarity:126/292 (43%) Gaps:47/292 (16%)


  Fly     8 VIIFKSESE---SSDVYAETLEKHDFNPVFVPTLSFGFKNLDELRAKLQNPDKYAGIIFTSPRCV 69
            |::.|...|   ..|.|...|..:......:|.|||.|.:|.....||.:|:.|.|:||||||.|
Human     3 VLLLKDAKEDDCGQDPYIRELGLYGLEATLIPVLSFEFLSLPSFSEKLSHPEDYGGLIFTSPRAV 67

  Fly    70 EAV---AESLNLGE-----LPGGWKMLHNYAVGEVTHNLALSTLDQLFTHGKQTGNARALGDYIV 126
            ||.   .|..|..|     |...|.....|.||..|.:| :|.:. |.|.|:..|||..|.:||.
Human    68 EAAELCLEQNNKTEVWERSLKEKWNAKSVYVVGNATASL-VSKIG-LDTEGETCGNAEKLAEYIC 130

  Fly   127 DTFDGSRALPLLLPCGNLATDTLLSKLAENGFSVDACEVYETRCHPELGANVERALEIYGESIEF 191
            ..  .|.|||||.|||||..:.|...|.:.|.::::..||:|..||.:..|:.......|.... 
Human   131 SR--ESSALPLLFPCGNLKREILPKALKDKGIAMESITVYQTVAHPGIQGNLNSYYSQQGVPAS- 192

  Fly   192 LAFFSPSGV----------------------------NCAQQYFTSRQLSMDKWKLVAIGPSTRR 228
            :.||||||:                            ||.|.....:..:.......||||:|.|
Human   193 ITFFSPSGLTYSLKHIQELSGDNIDQIKTQGPQHPKKNCLQLEPLRKDCTDTAVMFAAIGPTTAR 257

  Fly   229 ALESLGQKVYCTAERPTVEHL---VKVLLNP 256
            ||.:.|..|.||||.||.:.|   ::..|.|
Human   258 ALAAQGLPVSCTAESPTPQALATGIRKALQP 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uros1NP_001259362.1 HEM4 20..251 CDD:280722 89/270 (33%)
UROSNP_001310965.1 HemD 3..282 CDD:119440 93/284 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C237986486
eggNOG 1 0.900 E1_COG1587
Hieranoid 1 1.000
Homologene 1 1.000 H37296
Inparanoid 1 1.050 131 1.000 Inparanoid score I4558
Isobase 1 0.950 0 Normalized mean entropy S4099
OMA 1 1.010
OrthoDB 1 1.010 D1557657at2759
OrthoFinder 1 1.000 FOG0004425
OrthoInspector 1 1.000 T609722
orthoMCL 1 0.900 OOG5_131318
Panther 1 1.100 LDO PTHR12390
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2144
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.