DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uros1 and Uros2

DIOPT Version :8

Sequence 1:NP_001259362.1 Gene:Uros1 / 31817 FlyBaseID:FBgn0030066 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_650489.1 Gene:Uros2 / 41908 FlyBaseID:FBgn0038361 Length:253 Species:Drosophila melanogaster

Alignment Length:253 Identity:106/254 (42%)
Similarity:145/254 (57%) Gaps:2/254 (1%)


  Fly     1 MTSRQRTVIIFKSESESSDVYAETLEKHDFNPVFVPTLSFGFKNLDELRAKLQNPDKYAGIIFTS 65
            |..|.:..:|......|.|.|...|..|:.:|:|:....|.||||.:|:|||..|.|||||||.|
  Fly     1 MGDRNKQPVILLKVPSSDDFYGSALRSHNLDPIFITPSHFVFKNLKQLQAKLHEPHKYAGIIFAS 65

  Fly    66 PRCVEAVAESLNLGELPGGWKMLHNYAVGEVTHNLALSTLDQLFTHGKQTGNARALGDYIVDTFD 130
            ||||:||.|:|....||..|:.||||::|:.||:.|..|...|.|.|....||..|.|.||:||.
  Fly    66 PRCVQAVNEALGKTPLPSCWRALHNYSLGKNTHSAAWITFQNLPTLGDHAVNANNLCDLIVETFG 130

  Fly   131 GSRALPLLLPCGNLATDTLLSKLAENGFSVDACEVYETRCHPELGANVERALEIYGESIEFLAFF 195
            ..|.||||:||||....||..:|...||.||||||||:|.||:....:..||:.  :.:|.:.||
  Fly   131 PKRDLPLLMPCGNGVGQTLRLRLVAQGFRVDACEVYESRSHPDFVNQMRHALKF--KRMETIVFF 193

  Fly   196 SPSGVNCAQQYFTSRQLSMDKWKLVAIGPSTRRALESLGQKVYCTAERPTVEHLVKVL 253
            .||.|..:.::|.:..:|:...||:|:|..||:|:|..|.|.........|:.|:.::
  Fly   194 GPSSVRSSLEFFGNYNVSLKDRKLIAVGSGTRKAMEESGIKADGVVNAADVDRLINII 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uros1NP_001259362.1 HEM4 20..251 CDD:280722 101/231 (44%)
Uros2NP_650489.1 HemD 9..251 CDD:119440 104/244 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C237535950
eggNOG 1 0.900 E1_COG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4686
Isobase 1 0.950 0 Normalized mean entropy S4099
OrthoDB 1 1.010 D1557657at2759
OrthoFinder 1 1.000 FOG0004425
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12390
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.