DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and nf2

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_012820654.1 Gene:nf2 XenbaseID:XB-GENE-984959 Length:594 Species:Xenopus tropicalis

Alignment Length:671 Identity:271/672 (40%)
Similarity:383/672 (57%) Gaps:118/672 (18%)


  Fly    13 RYGGVSVKR---KTLNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGD 74
            |....|:||   ||..||:.|||||:||..:....||.|||.|.:|:||||.|||||||| .|..
 Frog     8 RMNFTSLKRKQPKTFIVRIITMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYT-VKDT 71

  Fly    75 STWIKLYKKPESPAIKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMN 139
            ..|:|:.||                                                     |::
 Frog    72 IAWLKMDKK-----------------------------------------------------VLD 83

  Fly   140 QDVKKENPLQFRFRAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQA 204
            .||.||.|:.|.|.||||||:|.|||:||||..||:||||..||.::||||||.|||||||||||
 Frog    84 HDVPKEEPVTFHFLAKFYPENVEEELVQDITQHLFFLQVKKQILEEKIYCPPEASVLLASYAVQA 148

  Fly   205 RHGDHNKTTHTAGFLANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQD 269
            ::||::.:.|..||||.:.|||:|||:.::|:.:.||:.|..|:.|||...|::|.|||||||||
 Frog   149 KYGDYDPSVHKRGFLAEEELLPKRVINLYQMTPEMWEERITAWYAEHRGRTRDEAEMEYLKIAQD 213

  Fly   270 LEMYGVNYFEIRNKKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDK 334
            .||||||||.|||||||:|.||||||||:||:.::|||||..|||:||||||:|:|:|.|||:||
 Frog   214 TEMYGVNYFLIRNKKGTELLLGVDALGLHIYDLENRLTPKTSFPWNEIRNISYSDKEFTIKPLDK 278

  Fly   335 KAPDFMFFAPRVRINKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQEREKLQLAL 399
            |...|.|.:.::|:||.||.||:|||:|:|||||.|:::||||||||||||..||.||::|....
 Frog   279 KIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREK 343

  Fly   400 AARERAEKKQQEYEDRLKQMQEDMERSQRDLLEAQDMIRRL-------EEQLKQLQAAKDELELR 457
            ..||.||:.:.|.|.||.|::|:.:.:...|:.:::....|       ||:.|.|.....|.|..
 Frog   344 QLREEAERARDELERRLLQLKEEAQMANDALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQE 408

  Fly   458 QKELQAMLQRLEEAKNMEAVEKLKLEEEIMAKQMEVQRIQDEVNAKDEETKRLQDEVEDA----- 517
            .:.::|...|.||       ||..:|:::|..:|...::.:|...:.:|.::|:.::::|     
 Frog   409 MQRIKATAIRNEE-------EKRLMEQKVMETEMLAIKMAEESERRVKEAEQLKQDLQEARDSER 466

  Fly   518 RRKQVIA--------AEAAAALLAASTTPQHHHVAEDENENEEELTNGDAGGDVSRDL-----DT 569
            |.||.:.        .:||.|..::||.|.               |:..:...:|..|     ||
 Frog   467 RAKQKLLEISSKTSYMQAAGAASSSSTVPP---------------TDVPSFSMLSDSLPYDFKDT 516

  Fly   570 D------EHIKDPIEDRRTLAERNERLHDQLKALKQDLAQSRDETKETANDKIHRENVRQGRDKY 628
            |      |..|:.:|    ..|::..|.:||..||.::...:.:.:|:|.|.:| ||   ...|.
 Frog   517 DMKRLSMEIEKEKVE----YMEKSRHLQEQLNELKTEIESLKLKERESAMDIMH-EN---AGSKQ 573

  Fly   629 KTLREIRKGNTKRRVDQFENM 649
            .|::::...:|:.||..||.:
 Frog   574 NTIKKLTLQSTQCRVAFFEEL 594

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 119/252 (47%)
FERM_N 28..83 CDD:286467 30/55 (55%)
FERM_M 163..278 CDD:278785 71/115 (62%)
FERM_C_ERM 272..368 CDD:270015 65/96 (68%)
GBP_C <375..497 CDD:303769 43/129 (33%)
ERM 403..649 CDD:279153 67/277 (24%)
coiled coil 464..477 CDD:293879 3/13 (23%)
coiled coil 486..497 CDD:293879 2/11 (18%)
nf2XP_012820654.1 B41 24..222 CDD:214604 119/252 (47%)
FERM_N 30..86 CDD:286467 31/110 (28%)
FERM_M 107..222 CDD:278785 71/115 (62%)
FERM_C_ERM 216..312 CDD:270015 65/96 (68%)
ATP-synt_B 316..>417 CDD:304375 36/101 (36%)
ERM 347..594 CDD:279153 67/277 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D281811at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.