DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and EZR

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001104547.1 Gene:EZR HGNCID:12691 Length:586 Species:Homo sapiens

Alignment Length:645 Identity:340/646 (53%)
Similarity:442/646 (68%) Gaps:82/646 (13%)


  Fly    22 KTLNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKLYKKPES 86
            |.:||||||||||||||||..||||||||||||||||||||:|||.|.|:||..||:||.||   
Human     3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKK--- 64

  Fly    87 PAIKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKKENPLQFR 151
                                                              |..|:|:|||||||:
Human    65 --------------------------------------------------VSAQEVRKENPLQFK 79

  Fly   152 FRAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTA 216
            |||||||||||||||||||.:||:||||..||:|||||||||:|||.||||||:.||:||..|.:
Human    80 FRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKS 144

  Fly   217 GFLANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIR 281
            |:|:::||:||||:||||:::|:||..|..|..|||.||:::||:|||||||||||||:|||||:
Human   145 GYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIK 209

  Fly   282 NKKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRV 346
            ||||||||||||||||||||:||:|||||||||||||||||::|||:|||||||||||:|:|||:
Human   210 NKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRL 274

  Fly   347 RINKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQQ- 410
            |||||||.||||||||||||||||||:||||||||||||:.||.||::|:.....||..|:::: 
Human   275 RINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQ 339

  Fly   411 ---EYED---RLKQMQEDMERSQRDLLEAQDMIRRLEEQLKQLQAAKDELELRQKELQAMLQRLE 469
               |.|:   ||:..:|..::::|:|.|......:|||:.|:   |::|.|..:.:..|.|:..|
Human   340 MMREKEELMLRLQDYEEKTKKAERELSEQIQRALQLEEERKR---AQEEAERLEADRMAALRAKE 401

  Fly   470 EAKNMEAVEKLKLEEEIMAKQME----VQRIQDEVNAKDEETKRLQDEVEDARRKQVIAAEAAAA 530
            |.:. :||:::|.:|::.|:..|    :..:::....|::|.:..|...::|:...|...|....
Human   402 ELER-QAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHL 465

  Fly   531 LLAASTTPQ-------HHHVAEDENENEEELTNGDAGGDVSRDLDTDEHIKDPIEDRR-TLAERN 587
            ::.|...|.       .:||.|...:...|.|.      .|.:|.::....|..|::| |.||:|
Human   466 VMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTG------YSAELSSEGIRDDRNEEKRITEAEKN 524

  Fly   588 ERLHDQLKALKQDLAQSRDETKETANDKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFE 647
            ||:..||..|..:|:|:|||.|.|.||.||.||:|||||||||||:||:||||:|:|:||
Human   525 ERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFE 584

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 147/252 (58%)
FERM_N 28..83 CDD:286467 45/55 (82%)
FERM_M 163..278 CDD:278785 78/115 (68%)
FERM_C_ERM 272..368 CDD:270015 85/96 (89%)
GBP_C <375..497 CDD:303769 44/133 (33%)
ERM 403..649 CDD:279153 88/265 (33%)
coiled coil 464..477 CDD:293879 4/13 (31%)
coiled coil 486..497 CDD:293879 2/15 (13%)
EZRNP_001104547.1 B41 7..206 CDD:214604 147/252 (58%)
[IL]-x-C-x-x-[DE] motif. {ECO:0000305|PubMed:25417112} 115..120 5/5 (100%)
FERM_C_ERM 200..296 CDD:270015 85/96 (89%)
Interaction with SCYL3. {ECO:0000269|PubMed:12651155} 244..586 156/352 (44%)
type_I_hlyD <295..>372 CDD:330453 34/77 (44%)
ERM 338..586 CDD:307079 86/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C72863100
eggNOG 1 0.900 E1_KOG3529
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 690 1.000 Inparanoid score I679
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D281811at33208
OrthoFinder 1 1.000 FOG0001007
OrthoInspector 1 1.000 T608927
orthoMCL 1 0.900 OOG5_129438
Panther 1 1.100 O PTHR23281
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4666
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.