DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and si:ch211-220f12.1

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_009291718.1 Gene:si:ch211-220f12.1 ZFINID:ZDB-GENE-050419-154 Length:1065 Species:Danio rerio

Alignment Length:610 Identity:128/611 (21%)
Similarity:234/611 (38%) Gaps:170/611 (28%)


  Fly    32 DAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKLYKKPESPAIKTIKYLK 96
            |.:||..:|.....|.|.|.|.....|:|..:||:.|.|..|..:|::|                
Zfish    61 DRKLELLVQPKLMAKDLLDLVASHFNLKEKEYFGISYVDETGHFSWLQL---------------- 109

  Fly    97 RVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKKENPLQFRFRAKFYPEDV 161
                  |::..:                              ::..||..|:...|..:||.|.:
Zfish   110 ------DRRVLE------------------------------HEFPKKSGPVVLYFCVRFYIESI 138

  Fly   162 AEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTAGFLANDRLLP 226
            : .|..:.|:.||:|..|:.|..:.|....|....||||.:|...||......|...|.....||
Zfish   139 S-YLKDNATIELFFLNAKSCIYKELIEVDSEVVFELASYILQEAKGDFTSNDVTRADLKKLPALP 202

  Fly   227 QRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTDLWLG 291
            .:.:.:|. |....|..::..:::.....|..|::.|:.|.:.|..|||:|:.:::|:|...|||
Zfish   203 TQALKEHP-SLAYCEDRVIEHYKKLSGQSRGQAIVNYMSIVESLPTYGVHYYAVKDKQGIPWWLG 266

  Fly   292 VDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRVRIN------- 349
            :...|:..|:..|::.|:..|.|.::.|:.|.||||.::..|          ||.|.:       
Zfish   267 LSYKGIFQYDYQDKVKPRKVFQWRQLENLYFREKKFSVEVHD----------PRSRASVTRRTFG 321

  Fly   350 ----------------KRILALCMGNHELYMRRRKPDT------------IDVQQ---------- 376
                            |.|.|:.:..|:.|:.|::..:            ||:.:          
Zfish   322 HSGIAVHTWYACPTLIKSIWAMAISQHQFYLDRKQSKSK
IHAARSLNEIAIDLTETGTLKTSKLA 386

  Fly   377 ---------------MKAQAREEKNAKQQEREKLQLALAARERAEKKQQEYEDRLKQMQEDMER- 425
                           :.:...:|.::.|..::.:..||.||      |:..|:.|:|..|:::. 
Zfish   387 NMGSKGKIISGSSGSLLSSGSQESDSSQTAKKDMLAALRAR------QEALEETLRQRIEELKNI 445

  Fly   426 --SQRDLL------------EAQDMIRR-------LEEQLKQLQAAKDELELRQKELQAMLQRLE 469
              .:.:|.            |....:||       |:||....:..::|||..::|...      
Zfish   446 CIREAELTGKLPKEYPLDPGEEPPTVRRKIGTAFKLDEQKILPKGEEEELERLEREFAI------ 504

  Fly   470 EAKNMEAVEKLKLEEEIMAKQMEVQRIQDEVNAKDEETKRLQDEVEDARRKQVIAAEAAAALLAA 534
            :::..||..:|..:..|.:|:::.||....:||    .|:||| :|:...:..:.:       ..
Zfish   505 QSQITEAARRLASDPHISSKKLKKQRKTSYLNA----LKKLQD-IENGINEYRVRS-------GK 557

  Fly   535 STTPQHHHVAEDENENEEELTNGDA 559
            ..|.:...:.|:.|...|:.:..||
Zfish   558 KPTQRASLIIEEANIGSEDSSLSDA 582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 57/246 (23%)
FERM_N 28..83 CDD:286467 17/51 (33%)
FERM_M 163..278 CDD:278785 32/115 (28%)
FERM_C_ERM 272..368 CDD:270015 31/119 (26%)
GBP_C <375..497 CDD:303769 29/169 (17%)
ERM 403..649 CDD:279153 36/180 (20%)
coiled coil 464..477 CDD:293879 2/13 (15%)
coiled coil 486..497 CDD:293879 4/11 (36%)
si:ch211-220f12.1XP_009291718.1 B41 53..253 CDD:214604 57/246 (23%)
FERM_N 56..116 CDD:286467 18/107 (17%)
FERM_M 139..253 CDD:278785 32/116 (28%)
FERM_C_FRMD4A_FRMD4B 249..360 CDD:270012 30/121 (25%)
DUF3338 417..522 CDD:288652 24/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.