DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and inavab

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001073474.1 Gene:inavab ZFINID:ZDB-GENE-061103-190 Length:612 Species:Danio rerio

Alignment Length:136 Identity:33/137 (24%)
Similarity:56/137 (41%) Gaps:44/137 (32%)


  Fly   408 KQQEYEDRLKQMQEDMER-------------SQRDLL--EAQDMIRR-------LEE-------Q 443
            |||..|||||....::::             |...||  |....|||       |:|       :
Zfish    40 KQQSLEDRLKMCLVELKKLCIREAELTGHLSSVYPLLPGEKPPQIRRRIGAAFKLDEPSILHRTE 104

  Fly   444 LKQLQAAKDELELRQKELQAMLQRLEEAKNMEAVEKLKLEEEIMAKQMEVQRIQDEVNAKDEETK 508
            ...|.:.:.:|.| |:::....|||             .:||.::|.::..|:| :...::.:.|
Zfish   105 NSALSSVEADLAL-QQQIYVAAQRL-------------CQEEHLSKGVKRSRLQ-QYQREERKLK 154

  Fly   509 RLQDEV 514
            .||:.|
Zfish   155 DLQEAV 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604
FERM_N 28..83 CDD:286467
FERM_M 163..278 CDD:278785
FERM_C_ERM 272..368 CDD:270015
GBP_C <375..497 CDD:303769 28/118 (24%)
ERM 403..649 CDD:279153 33/137 (24%)
coiled coil 464..477 CDD:293879 3/13 (23%)
coiled coil 486..497 CDD:293879 2/11 (18%)
inavabNP_001073474.1 DUF3338 8..136 CDD:288652 26/110 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.