DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and FRMD4A

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_006717520.1 Gene:FRMD4A HGNCID:25491 Length:1110 Species:Homo sapiens

Alignment Length:618 Identity:133/619 (21%)
Similarity:241/619 (39%) Gaps:161/619 (26%)


  Fly    32 DAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKLYKKPESPAIKTIKYLK 96
            |.:||..:|.....|:|.|.|.....|:|..:||:.:||..|...|::|.::             
Human    62 DRKLELLVQPKLLAKELLDLVASHFNLKEKEYFGIAFTDETGHLNWLQLDRR------------- 113

  Fly    97 RVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDV-KKENPLQFRFRAKFYPED 160
                                                    |:..|. ||..|:...|..:||.|.
Human   114 ----------------------------------------VLEHDFPKKSGPVVLYFCVRFYIES 138

  Fly   161 VAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGD--------HNKTTH--- 214
            :: .|..:.|:.||:|..|:.|..:.|....|....||||.:|...||        :::|..   
Human   139 IS-YLKDNATIELFFLNAKSCIYKELIDVDSEVVFELASYILQEAKGDFSSFLGPLYDRTKEQRA 202

  Fly   215 TAGFLAND----RLLPQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGV 275
            |...:.:|    ..||.:.:.:|. |....|..::..:::.....|..|::.|:.|.:.|..|||
Human   203 TNEVVRSDLKKLPALPTQALKEHP-SLAYCEDRVIEHYKKLNGQTRGQAIVNYMSIVESLPTYGV 266

  Fly   276 NYFEIRNKKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKK----- 335
            :|:.:::|:|...|||:...|:..|:..|::.|:..|.|.::.|:.|.||||.::..|.:     
Human   267 HYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKIFQWRQLENLYFREKKFSVEVHDPRRASVT 331

  Fly   336 ---------APDFMFFAPRVRINKRILALCMGNHELYMRRRKPDT------------IDVQQMKA 379
                     |....:..|  .:.|.|.|:.:..|:.|:.|::..:            ||:.: ..
Human   332 RRTFGHSGIAVHTWYACP--ALIKSIWAMAISQHQFYLDRKQSKSK
IHAARSLSEIAIDLTE-TG 393

  Fly   380 QAREEKNAKQQEREKL------------------QLALAARERAEKKQQEYED---RLKQMQEDM 423
            ..:..|.|....:.|:                  .:.|...:.::..|...:|   .||..||.:
Human   394 TLKTSKLANMGSKGKIISGSSGSLLSSGSGARRHCILLPGSQESDSSQSAKKDMLAALKSRQEAL 458

  Fly   424 ERSQRDLLEAQDMIRRLEEQL--------------------KQLQAA--KDELELRQKELQAMLQ 466
            |.:.|..||....:...|.:|                    :::..|  .||.::..|..:|.|:
Human   459 EETLRQRLEELKKLCLREAELTGKLPVEYPLDPGEEPPIVRRRIGTAFKLDEQKILPKGEEAELE 523

  Fly   467 RLE-----EAKNMEAVEKLKLEEEIMAKQMEVQRIQDEVNAKDEETKRLQDEVEDARRKQVIAAE 526
            |||     :::..||..:|..:..: :|:::.||....:||    .|:|| |:|:|..:..|.: 
Human   524 RLEREFAIQSQITEAARRLASDPNV-SKKLKKQRKTSYLNA----LKKLQ-EIENAINENRIKS- 581

  Fly   527 AAAALLAASTTPQHHHVAEDENENEEELTNGDA 559
                  ....|.:...:.:|.|...|:.:..||
Human   582 ------GKKPTQRASLIIDDGNIASEDSSLSDA 608

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 59/262 (23%)
FERM_N 28..83 CDD:286467 17/51 (33%)
FERM_M 163..278 CDD:278785 33/130 (25%)
FERM_C_ERM 272..368 CDD:270015 30/110 (27%)
GBP_C <375..497 CDD:303769 31/170 (18%)
ERM 403..649 CDD:279153 42/188 (22%)
coiled coil 464..477 CDD:293879 6/18 (33%)
coiled coil 486..497 CDD:293879 3/11 (27%)
FRMD4AXP_006717520.1 B41 54..269 CDD:214604 59/262 (23%)
FERM_N 57..118 CDD:286467 18/109 (17%)
FERM_M 140..269 CDD:278785 33/131 (25%)
FERM_C_FRMD4A_FRMD4B 265..375 CDD:270012 29/112 (26%)
DUF3338 429..551 CDD:288652 26/123 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.