DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and msnb

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001243180.1 Gene:msnb ZFINID:ZDB-GENE-030717-7 Length:577 Species:Danio rerio

Alignment Length:645 Identity:335/646 (52%)
Similarity:441/646 (68%) Gaps:87/646 (13%)


  Fly    23 TLNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKLYKKPESP 87
            ::|||||||||||||||||:||||||||||||||||||:|:|||||.||||.|||:||.|:    
Zfish     2 SINVRVTTMDAELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQYQDSKGFSTWLKLNKR---- 62

  Fly    88 AIKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKKENPLQFRF 152
                                                             |..|||:|||||..:|
Zfish    63 -------------------------------------------------VTAQDVRKENPLLIKF 78

  Fly   153 RAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTAG 217
            |||||||||||||||:.|.|||:||||.|||.|:|||||||:|||||||||.:|.|:|...|..|
Zfish    79 RAKFYPEDVAEELIQEATQRLFFLQVKEAILNDDIYCPPETAVLLASYAVQMKHSDYNSEHHIPG 143

  Fly   218 FLANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIRN 282
            :|..|:||||||::|||::|::|||.|..|.::|:||.|||||:|||||:|||||||||||.|:|
Zfish   144 YLCRDKLLPQRVLEQHKLTKEQWEQRIQVWHEQHKSMSREDAMIEYLKISQDLEMYGVNYFSIKN 208

  Fly   283 KKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRVR 347
            |||::||||||||||||||:.|:|||||||||||||||||::|||:|||||||:|||:|:|||:|
Zfish   209 KKGSELWLGVDALGLNIYERSDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKSPDFVFYAPRLR 273

  Fly   348 INKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQQ-- 410
            |||||||||||||:|||||||||||:|||||||||||||.:||||..|:.....||.|||:.:  
Zfish   274 INKRILALCMGNHDLYMRRRKPDTIEVQQMKAQAREEKNKRQQERALLENEKKRRENAEKETEKI 338

  Fly   411 -----EYEDRLKQMQEDMERSQRDLLEAQDMIRRLEEQLKQLQAAKDELE----LRQKELQAMLQ 466
                 |..:||:|::|..:::|.:|.|.......||.:.|..|...::||    :.:....|:||
Zfish   339 ARETMELMERLRQIEEQTKKAQEELEEQTKRALELERERKFAQEEAEKLEKDRRIAEDVKTALLQ 403

  Fly   467 RLE-EAKNMEAVEKLKLEEEIMAKQMEVQRIQDEVNAKDEETKRLQD-----EVEDARRKQVIAA 525
            :.| :.||     |..|..|:.....::..::|....|::|.::.|.     ||:..:.|:.:.:
Zfish   404 QSENQTKN-----KDNLATELAELTSKINLLEDAKKKKEDEARKWQRRAIMVEVDLEKTKEELKS 463

  Fly   526 EAAAALLAASTTPQHHHVAEDENENEEELTNGDAGGDVSRDLDTDEHIKDPIEDRR-TLAERNER 589
            :.....:.|:        ::.||:::|   |.::..:.|.:|.:....:|..|::| |..|:||.
Zfish   464 KLIGVHIQAT--------SQTENDHDE---NDESSAEASAELTSTGSFRDRSEEQRITETEKNEP 517

  Fly   590 LHDQLKALKQDLAQSRDETKETANDKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFENM 649
            |..:|:||..:||.:||::|:||||.||.||||.|||||||||:||:||||:|:|:||:|
Zfish   518 LQKRLQALSSELADARDDSKKTANDLIHAENVRLGRDKYKTLRQIRQGNTKQRIDEFESM 577

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 148/252 (59%)
FERM_N 28..83 CDD:286467 48/55 (87%)
FERM_M 163..278 CDD:278785 78/115 (68%)
FERM_C_ERM 272..368 CDD:270015 81/96 (84%)
GBP_C <375..497 CDD:303769 45/134 (34%)
ERM 403..649 CDD:279153 86/264 (33%)
coiled coil 464..477 CDD:293879 5/14 (36%)
coiled coil 486..497 CDD:293879 0/11 (0%)
msnbNP_001243180.1 B41 5..204 CDD:214604 148/252 (59%)
FERM_N 7..69 CDD:286467 52/115 (45%)
FERM_M 89..204 CDD:278785 78/115 (68%)
FERM_C_ERM 198..294 CDD:270015 81/96 (84%)
ERM 336..577 CDD:279153 82/257 (32%)
DUF342 <344..466 CDD:302792 30/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C72857864
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D281811at33208
OrthoFinder 1 1.000 FOG0001007
OrthoInspector 1 1.000 T596493
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23281
Phylome 1 0.910 0.793 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.