DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and Ezr

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_062230.1 Gene:Ezr RGDID:621161 Length:586 Species:Rattus norvegicus

Alignment Length:651 Identity:341/652 (52%)
Similarity:436/652 (67%) Gaps:90/652 (14%)


  Fly    22 KTLNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKLYKKPES 86
            |.:||||||||||||||||..||||||||||||||||||||:|||||.|:||..||:||.||   
  Rat     3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLKLDKK--- 64

  Fly    87 PAIKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKKENPLQFR 151
                                                              |..|:|:||||:||:
  Rat    65 --------------------------------------------------VSAQEVRKENPVQFK 79

  Fly   152 FRAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTA 216
            |||||||||||:|||||||.:||:||||..||:|||||||||:|||.||||||:.||:||..|.:
  Rat    80 FRAKFYPEDVADELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEMHKS 144

  Fly   217 GFLANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIR 281
            |:|:::||:||||:||||:|:|:||..|..|..|||.||::.||:|||||||||||||:|||||:
  Rat   145 GYLSSERLIPQRVMDQHKLSRDQWEDRIQVWHAEHRGMLKDSAMLEYLKIAQDLEMYGINYFEIK 209

  Fly   282 NKKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRV 346
            ||||||||||||||||||||:||:|||||||||||||||||::|||:|||||||||||:|:|||:
  Rat   210 NKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRL 274

  Fly   347 RINKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQ-- 409
            |||||||.||||||||||||||||||:||||||||||||:.||.||::|:.....||..|:::  
  Rat   275 RINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQ 339

  Fly   410 ------------QEYEDRLKQMQEDMERSQRDLLEAQDMIRRLEEQLKQLQA-------AKDELE 455
                        |::|.:.|:.::::.......|:.::..||.:|:.::|:|       ||:|||
  Rat   340 MLREKEELMLRLQDFEQKTKRAEKELSEQIEKALQLEEERRRAQEEAERLEADRMAALRAKEELE 404

  Fly   456 LRQKELQAMLQRLEEAKNMEAVEKLKLEEEIMAKQMEVQRIQDEVNAKDEETKRLQDEVEDARRK 520
             ||.:.|...|....|:..|...|:.|.||..      :|.:|||.......|..||::...:.:
  Rat   405 -RQAQDQIKSQEQLAAELAEYTAKIALLEEAR------RRKEDEVEEWQHRAKEAQDDLVKTKEE 462

  Fly   521 QVIAAEAAAALLAASTTPQHHHVAED-ENENEEELTNGDAGGDVSRDLDTDEHIKDPIEDRR-TL 583
            ..:...|..........|.::||.|. ::|..|.:       ..|.:|.::..:.|..|::| |.
  Rat   463 LHLVMTAPPPPPPPVYEPVNYHVQEGLQDEGAEPM-------GYSAELSSEGILDDRNEEKRITE 520

  Fly   584 AERNERLHDQLKALKQDLAQSRDETKETANDKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFEN 648
            ||:|||:..||..|..:|:|:|||.|.|.||.||.||:|||||||||||:||:||||:|:|:||.
  Rat   521 AEKNERVQRQLLTLSNELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEA 585

  Fly   649 M 649
            |
  Rat   586 M 586

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 147/252 (58%)
FERM_N 28..83 CDD:286467 46/55 (84%)
FERM_M 163..278 CDD:278785 78/115 (68%)
FERM_C_ERM 272..368 CDD:270015 85/96 (89%)
GBP_C <375..497 CDD:303769 44/143 (31%)
ERM 403..649 CDD:279153 88/269 (33%)
coiled coil 464..477 CDD:293879 3/13 (23%)
coiled coil 486..497 CDD:293879 1/11 (9%)
EzrNP_062230.1 B41 7..206 CDD:214604 147/252 (58%)
FERM_N 9..71 CDD:286467 50/115 (43%)
FERM_M 92..206 CDD:278785 78/114 (68%)
[IL]-x-C-x-x-[DE] motif. {ECO:0000250|UniProtKB:P15311} 115..120 5/5 (100%)
FERM_C_ERM 200..296 CDD:270015 85/96 (89%)
Interaction with SCYL3. {ECO:0000250} 244..586 156/356 (44%)
ERM 338..586 CDD:279153 86/262 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C72861019
eggNOG 1 0.900 E1_KOG3529
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 683 1.000 Inparanoid score I671
OMA 1 1.010
OrthoDB 1 1.010 D281811at33208
OrthoFinder 1 1.000 FOG0001007
OrthoInspector 1 1.000 T617864
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23281
Phylome 1 0.910 0.750 Consistency score
TreeFam 1 0.960
1110.870

Return to query results.
Submit another query.