DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and rdx

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_002938008.3 Gene:rdx XenbaseID:XB-GENE-990892 Length:590 Species:Xenopus tropicalis

Alignment Length:661 Identity:356/662 (54%)
Similarity:452/662 (68%) Gaps:106/662 (16%)


  Fly    22 KTLNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKLYKKPES 86
            |.:||||||||||||||||..|||||||||||||:||||||||||||.||||.|||:||.||   
 Frog     3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKK--- 64

  Fly    87 PAIKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKKENPLQFR 151
                                                              |..|||:|||||||:
 Frog    65 --------------------------------------------------VTQQDVRKENPLQFK 79

  Fly   152 FRAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTA 216
            |||||:||||:|||||:||.|||:||||.|||.|||||||||:||||||||||::||::|..|..
 Frog    80 FRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYSKEAHKP 144

  Fly   217 GFLANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIR 281
            |:|||||||||||::|||::|::||:.|.||.:|||||||||:|||||||||||||||||||||:
 Frog   145 GYLANDRLLPQRVLEQHKLTKEQWEERIQTWHEEHRSMLREDSMMEYLKIAQDLEMYGVNYFEIK 209

  Fly   282 NKKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRV 346
            |||||:||||||||||||||.||:|||||||||||||||||::|||:|||||||||||:|:|||:
 Frog   210 NKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRL 274

  Fly   347 RINKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQER-------EKLQLALAARER 404
            ||||||||||||||||||||||||||:||||||||||||:.||.||       :|.::|...:||
 Frog   275 RINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKER 339

  Fly   405 AEKKQQEYEDRLKQMQEDMERSQRDLLEAQDMIRRLEEQLKQLQAAKDELELRQKELQAMLQRLE 469
            .|:::.|..:||:|::|...::|::|.|.......|:::.|:   ||:|.|..:||.||    .|
 Frog   340 IEREKDELIERLRQIEEQTLKAQKELEEQTRKALELDQERKR---AKEEAERLEKERQA----AE 397

  Fly   470 EAKN---MEAVEKLKLEEEIMAKQME----VQRIQDEVNAKDEETKRLQDEVEDARRKQVIAAEA 527
            |||:   .:|.:::|.:|::.|:..|    :..:::....|:||....|.:...|:.......|.
 Frog   398 EAKSALAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEASEWQHKAYTAQEDLEKTKEE 462

  Fly   528 AAALLAASTTP----------------QHHHVAEDENENEEELTNGDAGGDVSRDLDTD---EHI 573
            ...:::|...|                :|.|..:|||..|           .|.:|.::   .|.
 Frog   463 LKTVMSAPPPPPPPQLLPPPPVAPTENEHDHDEQDENSAE-----------ASAELSSEGVMNHR 516

  Fly   574 KDPIEDRRTLAERNERLHDQLKALKQDLAQSRDETKETANDKIHRENVRQGRDKYKTLREIRKGN 638
            .:  |:|.|..::|||:..||:||..:|||:|||||:|.||.:|.|||:.|||||||||:||:||
 Frog   517 SE--EERLTETQKNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGN 579

  Fly   639 TKRRVDQFENM 649
            ||:|:|:||.|
 Frog   580 TKQRIDEFEAM 590

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 159/252 (63%)
FERM_N 28..83 CDD:286467 48/55 (87%)
FERM_M 163..278 CDD:278785 88/115 (77%)
FERM_C_ERM 272..368 CDD:270015 86/96 (90%)
GBP_C <375..497 CDD:303769 47/136 (35%)
ERM 403..649 CDD:279153 91/272 (33%)
coiled coil 464..477 CDD:293879 5/16 (31%)
coiled coil 486..497 CDD:293879 2/15 (13%)
rdxXP_002938008.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C72865560
eggNOG 1 0.900 E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D281811at33208
OrthoFinder 1 1.000 FOG0001007
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.