DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and nf2b

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_998116.1 Gene:nf2b ZFINID:ZDB-GENE-040622-3 Length:586 Species:Danio rerio

Alignment Length:617 Identity:252/618 (41%)
Similarity:366/618 (59%) Gaps:88/618 (14%)


  Fly    16 GVSVKR-KTLNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIK 79
            |:..|: ||..|:|:|||||:||:.:....||.|||.|.:||||||.|||||:|| .|....|:|
Zfish     5 GLKKKQPKTFKVKVSTMDAEMEFSCEVKWKGKDLFDLVCRTIGLRETWFFGLRYT-VKDTYAWLK 68

  Fly    80 LYKKPESPAIKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKK 144
                                  .||:                               |::|:|.|
Zfish    69 ----------------------PDKR-------------------------------VLDQEVPK 80

  Fly   145 ENPLQFRFRAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDH 209
            ::|:.|.|.|||:||.|.:||:|:||..||:||||..||.:||:|.||.|||||||||||::||:
Zfish    81 DSPITFHFLAKFFPEKVEDELVQEITQHLFFLQVKKQILDEEIFCSPEASVLLASYAVQAKYGDY 145

  Fly   210 NKTTHTAGFLANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYG 274
            :...|..||||.|.|||:||:.|::|:.|.||:.|..|:.|||::.|::|.||||||||||:|||
Zfish   146 DPNFHKPGFLAQDELLPKRVLMQYQMTPDMWEEKITAWYAEHRNITRDEAEMEYLKIAQDLDMYG 210

  Fly   275 VNYFEI-RNKKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPD 338
            |:||.| :||:.|:|.|||||.||:||..:::|:|...||||.|||||:|||:|.|||:|||...
Zfish   211 VSYFSITQNKRDTELLLGVDAQGLHIYNPNNKLSPNKSFPWSGIRNISYSEKEFTIKPLDKKKEV 275

  Fly   339 FMFFAPRVRINKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALAARE 403
            |.|::.::|:||.||.||:|||:|:|||||.|:|:||||||||:|||..|:.||:.|......||
Zfish   276 FKFYSSQLRVNKLILQLCIGNHDLFMRRRKVDSIEVQQMKAQAKEEKARKKVERQILAREKQMRE 340

  Fly   404 RAEKKQQEYEDRLKQMQEDMERSQRDLLEAQDMIRRL-------EEQLKQL--QAAKDELELRQK 459
            .||:.::|.|.|:.|:|::...:...||.:::....|       ||:.|.|  :||:.|.|.::.
Zfish   341 EAERAKEEMERRMFQLQDEARMANEALLRSEETADLLAEKAQIAEEEAKLLAHKAAEAEQERQRL 405

  Fly   460 ELQAML----QRLEEAKNMEAVE-KLKLEEEIMAKQMEVQRIQDEVN-AKDEETKRLQDEVEDAR 518
            |:.|:.    :||.|.|..||.: .:||.|:...:..|...::.::| |||.|.:        |:
Zfish   406 EVTALKTKEEKRLMEQKMREAEQLAVKLVEQSERRLKEADHLKQDLNEAKDAERR--------AK 462

  Fly   519 RKQVIAAEAAAALLAASTTPQHHHVAEDENENEEELTNGDAGGDVSRDL-DTD-EHIKDPIE-DR 580
            :|.:...:....|:||.:.|. .....:..|...|:     |..:..|. |:| :.:...|| :|
Zfish   463 QKLLEITKTTYPLIAAYSNPP-PPAGPESPEMAIEM-----GNPIQMDFKDSDMKRLSMEIERER 521

  Fly   581 RTLAERNERLHDQLKALKQDLAQSRDETKETA 612
            ....|:::.|.||||.||.::...:.|.::.|
Zfish   522 LEYMEKSKHLQDQLKELKSEIESLKLEEQQQA 553

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 115/252 (46%)
FERM_N 28..83 CDD:286467 30/55 (55%)
FERM_M 163..278 CDD:278785 69/115 (60%)
FERM_C_ERM 272..368 CDD:270015 58/97 (60%)
GBP_C <375..497 CDD:303769 46/136 (34%)
ERM 403..649 CDD:279153 61/229 (27%)
coiled coil 464..477 CDD:293879 6/17 (35%)
coiled coil 486..497 CDD:293879 1/11 (9%)
nf2bNP_998116.1 B41 15..214 CDD:214604 115/253 (45%)
FERM_N 18..76 CDD:286467 33/112 (29%)
FERM_M 100..214 CDD:278785 69/114 (61%)
FERM_C_ERM 208..305 CDD:270015 58/97 (60%)
ERM 346..551 CDD:279153 57/219 (26%)
GBP_C <362..467 CDD:303769 30/113 (27%)
coiled coil 454..465 CDD:293879 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D281811at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.