DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and ezra

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001018326.1 Gene:ezra ZFINID:ZDB-GENE-050522-18 Length:595 Species:Danio rerio

Alignment Length:653 Identity:346/654 (53%)
Similarity:447/654 (68%) Gaps:89/654 (14%)


  Fly    22 KTLNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKLYKKPES 86
            |.:|||||||||||||||||.|||||||:|||||:||||:|:||||:||:||..||:||.||   
Zfish     3 KPINVRVTTMDAELEFAIQSVTTGKQLFEQVVKTVGLREIWYFGLQFTDNKGFLTWLKLDKK--- 64

  Fly    87 PAIKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKKENPLQFR 151
                                                              |.:|:||:||||||:
Zfish    65 --------------------------------------------------VSSQEVKQENPLQFK 79

  Fly   152 FRAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTA 216
            ||||.|||||:||||||||.:||:||||.:||:|||||||||:|||||||||::.||....||..
Zfish    80 FRAKHYPEDVSEELIQDITKKLFFLQVKESILSDEIYCPPETAVLLASYAVQSKFGDFTPETHKT 144

  Fly   217 GFLANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIR 281
            |:|:::|||||||:||||:||::||:.|..|.:|||.:|:||:|:|||||:|||||||||||:|:
Zfish   145 GYLSSERLLPQRVLDQHKLSKEQWEERIQIWHEEHRGILKEDSMLEYLKISQDLEMYGVNYFDIK 209

  Fly   282 NKKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRV 346
            ||||||||||||||||||||:||||||||||||||||||||::|||||||||||||||:|:|.|:
Zfish   210 NKKGTDLWLGVDALGLNIYEKDDRLTPKIGFPWSEIRNISFNDKKFIIKPIDKKAPDFVFYASRL 274

  Fly   347 RINKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALAAR-------ER 404
            |||||||.||||||||||:|||||||:||||||||||||:.:|.||.:|:.....|       |.
Zfish   275 RINKRILQLCMGNHELYMKRRKPDTIEVQQMKAQAREEKHQRQMERAQLENEKKKREAIEKEKEM 339

  Fly   405 AEKKQQEYEDRLKQMQEDMERSQRDLLEAQDMIRRLEEQLKQLQAAKDELELRQKELQAMLQRLE 469
            .||::||...:|.|.:|..::.:|||.|..:..|.|||:.::::.....||   .|.||.|...|
Zfish   340 VEKEKQEMMMKLYQFEEQTKKVERDLREQFERARVLEEERRKVEEEAARLE---AERQAALMAKE 401

  Fly   470 EAKNMEAVEKLKLEEEI----------MAKQMEVQRI-QDEVNAKDEETKRLQDEVEDARRK--Q 521
            |... :|.:::|.:|::          :|...|.:|| ::|.|......|.:||::|..|.:  .
Zfish   402 ELAR-QAEDQMKTQEQLAADLAEYTAKLALLEEARRIKEEEANEWQNRAKEVQDDLEKTREELHN 465

  Fly   522 VIAAEAAAALLAAS-TTPQHHHVAED---ENENEEELTNGDAGGDVSRDLDT---DEHIKDPIED 579
            |:|:..|||.:||| ..|.......:   ||::|:...|...   .|.:|..   ::|..:  |:
Zfish   466 VMASPVAAAPMAASMAAPMAARAMMEEPLENDHEDHEENNST---YSAELPVEGIEDHRNE--EE 525

  Fly   580 RRTLAERNERLHDQLKALKQDLAQSRDETKETANDKIHRENVRQGRDKYKTLREIRKGNTKRRVD 644
            |.|.||:|||:..||.||..:||::||.||:|.||.:|.|||:.|||||||||:||.||||:|:|
Zfish   526 RITEAEKNERVQKQLMALSSELAEARDNTKKTQNDILHSENVQAGRDKYKTLRQIRMGNTKQRID 590

  Fly   645 QFE 647
            :||
Zfish   591 EFE 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 145/252 (58%)
FERM_N 28..83 CDD:286467 44/55 (80%)
FERM_M 163..278 CDD:278785 79/115 (69%)
FERM_C_ERM 272..368 CDD:270015 85/96 (89%)
GBP_C <375..497 CDD:303769 47/140 (34%)
ERM 403..649 CDD:279153 98/266 (37%)
coiled coil 464..477 CDD:293879 4/13 (31%)
coiled coil 486..497 CDD:293879 4/22 (18%)
ezraNP_001018326.1 B41 7..206 CDD:214604 145/252 (58%)
FERM_N 9..71 CDD:286467 48/115 (42%)
FERM_M 91..206 CDD:278785 79/115 (69%)
FERM_C_ERM 200..296 CDD:270015 85/96 (89%)
ERM 347..595 CDD:279153 93/257 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C72862992
eggNOG 1 0.900 E1_KOG3529
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 658 1.000 Inparanoid score I732
OMA 1 1.010
OrthoDB 1 1.010 D281811at33208
OrthoFinder 1 1.000 FOG0001007
OrthoInspector 1 1.000 T596493
orthoMCL 1 0.900 OOG5_129438
Panther 1 1.100 O PTHR23281
Phylome 1 0.910 0.774 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.