DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Moe and Inava

DIOPT Version :9

Sequence 1:NP_727290.1 Gene:Moe / 31816 FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_006249982.1 Gene:Inava / 289399 RGDID:1311892 Length:678 Species:Rattus norvegicus


Alignment Length:333 Identity:66/333 - (19%)
Similarity:127/333 - (38%) Gaps:66/333 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 WEQSIMT------WWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIRNK-KGTDLWLGVDA--- 294
            ||.|.:.      |.:...|.|...:..:.:..::|         |:.:. .|..|..|.|:   
  Rat    70 WENSRLPTHPGPGWDRRSPSFLAAPSSQKLIMESKD---------EVSDSDSGIILQSGPDSPVS 125

  Fly   295 ----LGLNIYEQDDRLTPKIGFPWSEIRNISFSE--------KKFIIKPIDKKAPDFMFFAPRVR 347
                |...:.:|...|..::.....|:|.:...|        .::.:||.:|        ||:||
  Rat   126 PMKELTNAVRKQQRALEARLEACLEELRRLCLREAELTGTLPAEYPLKPGEK--------APKVR 182

  Fly   348 INKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQQEY 412
               |.:.......|..:.|..|.:...:|:..|.:..:.|::...|:.....|.|:|.....|| 
  Rat   183 ---RRIGAAYKLDEWALHREDPLSSLERQLALQLQITEAARRLCAEENLSRQARRQRKHAALQE- 243

  Fly   413 EDRLKQMQEDMERSQRDLLEAQDMIRRLEEQLKQL--QAAKDELELRQKELQAMLQRLEE----- 470
            |.:|:.:|..:...:|:.......:..|..:|...  .:..|.|.|.:::.||.....|.     
  Rat   244 EKKLRDLQRCLGDRRRNSEPPPSTVPSLGRELSASDDSSLSDGLLLEEEDSQAPKPPPESPAPPS 308

  Fly   471 ----AKNMEAVEKLKLEEEIMAKQMEVQRIQDEVNAKDEETKRLQDEVEDARRKQVIAAEAAAAL 531
                .:::|.::....|    :..:|...||   |:..:||. |....|..|:...:::|::   
  Rat   309 RPLPPQSLEGLQPTGPE----SGGLERAPIQ---NSPWKETS-LDHPYEKPRKSSELSSESS--- 362

  Fly   532 LAASTTPQ 539
             :.:||||
  Rat   363 -SPATTPQ 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 7/43 (16%)
FERM_N 28..83 CDD:286467
FERM_M 163..278 CDD:278785 7/43 (16%)
FERM_C_ERM 272..368 CDD:270015 21/111 (19%)
GBP_C <375..497 CDD:303769 24/132 (18%)
ERM 403..649 CDD:279153 31/148 (21%)
coiled coil 464..477 CDD:293879 2/21 (10%)
coiled coil 486..497 CDD:293879 1/10 (10%)
InavaXP_006249982.1 DUF3338 108..231 CDD:288652 25/133 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.