DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and msna

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001004296.1 Gene:msna ZFINID:ZDB-GENE-021211-2 Length:579 Species:Danio rerio

Alignment Length:658 Identity:346/659 (53%)
Similarity:442/659 (67%) Gaps:111/659 (17%)


  Fly    22 KTLNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKLYKKPES 86
            ||::|||||||||||||||.:||||||||||||||||||||||||||.|:||.|||:||.||   
Zfish     3 KTISVRVTTMDAELEFAIQPSTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKK--- 64

  Fly    87 PAIKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKKENPLQFR 151
                                                              |..|||:||:||.|:
Zfish    65 --------------------------------------------------VTAQDVRKESPLLFK 79

  Fly   152 FRAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTA 216
            ||||||||||:|||||:.|.|||:||||..||.|:|||||||:||||||||||::.|:||..||.
Zfish    80 FRAKFYPEDVSEELIQEATQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQAKYADYNKDAHTP 144

  Fly   217 GFLANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIR 281
            |:|:|::||||||::|||::|::||:.|..|.:||:.|||||:|||||||||||||||||||.|:
Zfish   145 GYLSNEKLLPQRVLEQHKLNKEQWEERIQVWHEEHKGMLREDSMMEYLKIAQDLEMYGVNYFSIK 209

  Fly   282 NKKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRV 346
            ||||::|||||||||||||||:|::||||||||||||||||::|||:|||||||||||:|:|.|:
Zfish   210 NKKGSELWLGVDALGLNIYEQNDKMTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAQRL 274

  Fly   347 RINKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAK-------QQEREKLQLALAARER 404
            ||||||||||||||||||||||||||:||||||||:||||.|       :.||:|.:.|...:|:
Zfish   275 RINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAKEEKNHKKMERALLEDERKKREQAEKEKEK 339

  Fly   405 AEKKQQEYEDRLKQMQEDMERSQRDLLEAQDMIRRLEEQLKQLQAAKDELE----LRQKELQAML 465
            .||:::|..:||:.::|...::|::|.|.......||::.|:.|...:.||    |.::...|:|
Zfish   340 IEKEKEELMERLRVIEEQTRKAQQELEEQTRKALELEQERKRAQEEAERLERERRLAEEAKSALL 404

  Fly   466 QRLE-EAKNME--AVE--------------KLKLEEEIMAKQMEVQRIQDEVNAKDEETKRLQDE 513
            |:.| :.||.|  |.|              |.|.|:|.:..|.:...:|:::....||.|     
Zfish   405 QQSESQMKNQEHLATELAELTSKISLLEDAKKKKEDEALEWQTKATMVQEDLEKTKEELK----- 464

  Fly   514 VEDARRKQVIAAEAAAALLAASTTPQHHHVAEDENENEEELTNGD-AGGDVSRDLDTDEHIKDPI 577
                  .:|:::..        |.|.|     .||:|:|    || :..:.|.:|.:....||..
Zfish   465 ------NKVMSSHV--------TEPVH-----GENDNDE----GDESSAEASAELTSAAAYKDRS 506

  Fly   578 EDRR-TLAERNERLHDQLKALKQDLAQSRDETKETANDKIHRENVRQGRDKYKTLREIRKGNTKR 641
            |:.| |.||:|||:...|.||..:||.:|||||:|.||.||.||||.|||||||||:||.||||:
Zfish   507 EEERMTEAEKNERVQKHLLALTSELANARDETKKTQNDIIHAENVRAGRDKYKTLRQIRSGNTKQ 571

  Fly   642 RVDQFENM 649
            |:|:||.|
Zfish   572 RIDEFECM 579

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 150/252 (60%)
FERM_N 28..83 CDD:286467 48/55 (87%)
FERM_M 163..278 CDD:278785 80/115 (70%)
FERM_C_ERM 272..368 CDD:270015 82/96 (85%)
GBP_C <375..497 CDD:303769 47/150 (31%)
ERM 403..649 CDD:279153 95/269 (35%)
coiled coil 464..477 CDD:293879 7/16 (44%)
coiled coil 486..497 CDD:293879 1/11 (9%)
msnaNP_001004296.1 B41 7..206 CDD:214604 150/252 (60%)
FERM_N 9..71 CDD:286467 53/115 (46%)
FERM_M 91..206 CDD:278785 80/115 (70%)
FERM_C_ERM 200..296 CDD:270015 82/96 (85%)
ERM 347..579 CDD:279153 91/260 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C72858535
eggNOG 1 0.900 E1_KOG3529
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 658 1.000 Inparanoid score I732
OMA 1 1.010
OrthoDB 1 1.010 D281811at33208
OrthoFinder 1 1.000 FOG0001007
OrthoInspector 1 1.000 T596493
orthoMCL 1 0.900 OOG5_129438
Panther 1 1.100 O PTHR23281
Phylome 1 0.910 0.774 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4666
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.