DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and Frmd4b

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_001077268.4 Gene:Frmd4b RGDID:620172 Length:1035 Species:Rattus norvegicus

Alignment Length:700 Identity:145/700 (21%)
Similarity:268/700 (38%) Gaps:201/700 (29%)


  Fly    32 DAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKLYKKPESPAIKTIKYLK 96
            |..||..:|.....::|.|.|.....|:|..:||:.:.|..|...|::|                
  Rat    68 DRRLELLVQPKLLSRELLDLVASHFNLKEKEYFGITFIDDTGQENWLQL---------------- 116

  Fly    97 RVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKKENPLQFRFRAKFYPEDV 161
                       |...:.|               .:|          ||..|....|..:||.|.:
  Rat   117 -----------DHRVLEH---------------DLP----------KKPGPAVLHFAVRFYIESI 145

  Fly   162 AEELIQD-ITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTAGFLANDRLL 225
            :  .::| .|:.||:|..|..:...:|....||...||:..:|...||:....:....|....:.
  Rat   146 S--FLKDKNTVELFFLNAKACVHKGQIEVDSETIFKLAALVLQESKGDYTSDENARKDLKTLPVF 208

  Fly   226 PQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTDLWL 290
            |.:.:.:|. |....|..::..:.:.:.:.|..|:::|:||.:.|..|||:|:.:::|:|...||
  Rat   209 PTKTLQEHP-SLAYCEDRVIEHYLKIKGLTRGQAVVQYMKIVEALPTYGVHYYAVKDKQGLPWWL 272

  Fly   291 GVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRVRINKR---- 351
            |:...|:..|:..|::.|:..|.|.::.|:.|.||||.::..|.:         |:.:::|    
  Rat   273 GISYKGIGQYDLQDKVKPRKLFQWKQLENLYFREKKFAVEVHDPR---------RISVSRRTFGQ 328

  Fly   352 -----------------ILALCMGNHELYMRR----------RKPDTIDVQ-------------- 375
                             |..:.:..|:.|:.|          |..|.|.:.              
  Rat   329 SGLFVQTWYANSSLIKSIWVMAISQHQFYLDRKQSKAKIPSARSLDDIAMDLTETGTQRVSKLVT 393

  Fly   376 -QMKAQ-------------AREEKNAKQQEREKLQLALAARER--AEKKQQEYEDRLKQMQEDME 424
             :.|:|             :::.:..::|:|||: |.|..:|:  .||..::.|:..|....:.|
  Rat   394 LEAKSQFIMASNGSLISSGSQDSEGMEEQKREKI-LELKKKEKLLQEKLLKKVEELKKICLREAE 457

  Fly   425 RSQR-------DLLEAQDMIRR-------LEEQLKQLQAAKDELELRQKELQAMLQRLEEAKNME 475
            .:.|       ::.|....:||       |::   .|...:::..|::.|...::|:    |.:|
  Rat   458 LTGRMPKEYPLNIGEKPPQVRRRVGTTFKLDD---NLLPTEEDPALQELESNFLIQQ----KLVE 515

  Fly   476 AVEKLKLEEEIMAKQMEVQRIQDEVNAKDEETKRLQDEVEDARRKQVIAAEAAAALLAASTTPQH 540
            |.:||..|.: :.|.::.:|.||..:|    .|||| |:|::..:..|......:..||...|: 
  Rat   516 AAKKLASEPD-LCKTVKKKRKQDYTDA----VKRLQ-EIENSINEYRIRCGKKPSQKAAVVPPE- 573

  Fly   541 HHVAEDENENEEELTNGDAGGDVSRDLDTDEHIKDPIEDRRTLAERN------------------ 587
             .:...|:.:..:.|..|                || .|..|||.:.                  
  Rat   574 -DIIPSESSSLSDTTTYD----------------DP-NDSFTLAGQRPSSVPHSPRILPPKSLGI 620

  Fly   588 ERLHDQLKALKQDLAQSRDETKETANDKIHRENVRQGRDKYKTLREIRKG 637
            ||:|.:..::.:....:|..          ||.:......||||....:|
  Rat   621 ERIHFRKSSINEQFVDTRQS----------REMLSTHSSPYKTLERRPQG 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 54/247 (22%)
FERM_N 28..83 CDD:286467 15/51 (29%)
FERM_M 163..278 CDD:278785 29/116 (25%)
FERM_C_ERM 272..368 CDD:270015 29/127 (23%)
GBP_C <375..497 CDD:303769 31/166 (19%)
ERM 403..649 CDD:279153 56/269 (21%)
coiled coil 464..477 CDD:293879 4/13 (31%)
coiled coil 486..497 CDD:293879 2/11 (18%)
Frmd4bXP_001077268.4 B41 75..260 CDD:214604 51/240 (21%)
FERM_N 75..124 CDD:286467 14/91 (15%)
FERM_M 146..260 CDD:278785 29/117 (25%)
FERM_C_FRMD4A_FRMD4B 256..366 CDD:270012 27/119 (23%)
DUF3338 401..529 CDD:288652 28/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.