DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and Frmd4a

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_006497499.1 Gene:Frmd4a MGIID:1919850 Length:1061 Species:Mus musculus

Alignment Length:714 Identity:157/715 (22%)
Similarity:284/715 (40%) Gaps:178/715 (25%)


  Fly     1 MVV---VSDSR----VRLPRYGGV---SVKRKTLNVRVTTM---DAELEFAIQSTTTGKQLFDQV 52
            |||   |:.:|    :::| ||.:   ||:|.|...|....   |.:||..:|.....|:|.|.|
Mouse     1 MVVQTAVTPNRPQRLLKIP-YGSLRRRSVERMTEGRRCQVHLLDDRKLELLVQPKLLAKELLDLV 64

  Fly    53 VKTIGLREVWFFGLQYTDSKGDSTWIKLYKKPESPAIKTIKYLKRVKKYVDKKTADSNGVNHLET 117
            .....|:|..:||:.:||..|...|::|.::                                  
Mouse    65 ASHFNLKEKEYFGIAFTDETGHLNWLQLDRR---------------------------------- 95

  Fly   118 SEEDDDADDMTGSMPFSTWVMNQDV-KKENPLQFRFRAKFYPEDVAEELIQDITLRLFYLQVKNA 181
                               |:..|. ||..|:...|..:||.|.:: .|..:.|:.||:|..|:.
Mouse    96 -------------------VLEHDFPKKSGPVVLYFCVRFYIESIS-YLKDNATIELFFLNAKSC 140

  Fly   182 ILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTAGFLANDRLLPQRVIDQHKMSKDEWEQSIMT 246
            |..:.|....|....||||.:|...||.:........|.....||.:.:.:|. |....|..::.
Mouse   141 IYKELIDVDSEVVFELASYILQEAKGDFSSNEVVRSDLKKLPALPTQALKEHP-SLAYCEDRVIE 204

  Fly   247 WWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTDLWLGVDALGLNIYEQDDRLTPKIG 311
            ::::.....|..|::.|:.|.:.|..|||:|:.:::|:|...|||:...|:..|:..|::.|:..
Mouse   205 YYKKLNGQTRGQAIVNYMSIVESLPTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKI 269

  Fly   312 FPWSEIRNISFSEKKFIIKPIDKK--------------APDFMFFAPRVRINKRILALCMGNHEL 362
            |.|.::.|:.|.||||.::..|.:              |....:..|  .:.|.|.|:.:..|:.
Mouse   270 FQWRQLENLYFREKKFSVEVHDPRRASVTRRTFGHSGIAVHTWYACP--ALIKSIWAMAISQHQF 332

  Fly   363 YMRRRKPDT------------IDVQQ-------------------------MKAQAREEKNAKQQ 390
            |:.|::..:            ||:.:                         :.:...:|.::.|.
Mouse   333 YLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGKIISGSSGSLLSSGSQESDSSQS 397

  Fly   391 EREKLQLALAARERAEKKQQEYEDRLKQMQEDMER---SQRDLL------------EAQDMIRRL 440
            .::.:..||.:|      |:..|:.|:|..|:::|   .:.:|.            |...::||.
Mouse   398 AKKDMLAALKSR------QEALEETLRQRLEELKRLCLREAELTGKLPVEYPLDPGEEPPIVRRR 456

  Fly   441 EEQLKQLQAAKDELELRQKELQAMLQRLE-----EAKNMEAVEKLKLEEEIMAKQMEVQRIQDEV 500
            .....:|    ||.::..|..:|.|:|||     :::..||..:|..:..: :|:::.||....:
Mouse   457 IGTAFKL----DEQKILPKGEEAELERLEREFAIQSQITEAARRLASDPNV-SKKLKKQRKTSYL 516

  Fly   501 NAKDEETKRLQDEVEDARRKQVIAAEAAAALLAASTTPQHHHVAEDENENEEELTNGDA---GGD 562
            ||    .|:|| |:|:|..:..|.:       ....|.:...|.:|.|...|:.:..||   ..:
Mouse   517 NA----LKKLQ-EIENAINENRIKS-------GKKPTQRASLVIDDGNIASEDSSLSDALVLEDE 569

  Fly   563 VSRDLDTDEHIKDPIEDRRTLAERNERLHDQ------LKALKQDLAQSRDETKETANDKIHREN 620
            .|:...|...::.|   .:.|..|....|::      |:.|:|......|..|.....|:..|:
Mouse   570 DSQVTSTISPLQSP---HKGLPPRPPSSHNRPPPPQSLEGLRQLHYHRTDYDKSPLKPKMWSES 630

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 58/256 (23%)
FERM_N 28..83 CDD:286467 17/58 (29%)
FERM_M 163..278 CDD:278785 31/115 (27%)
FERM_C_ERM 272..368 CDD:270015 30/110 (27%)
GBP_C <375..497 CDD:303769 30/167 (18%)
ERM 403..649 CDD:279153 54/248 (22%)
coiled coil 464..477 CDD:293879 6/18 (33%)
coiled coil 486..497 CDD:293879 3/11 (27%)
Frmd4aXP_006497499.1 B41 36..236 CDD:214604 58/255 (23%)
FERM_N 39..100 CDD:286467 18/114 (16%)
FERM_M 122..236 CDD:278785 31/116 (27%)
FERM_C_FRMD4A_FRMD4B 232..342 CDD:270012 29/112 (26%)
DUF3338 399..506 CDD:288652 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.