DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and Rdx

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_001098086.1 Gene:Rdx MGIID:97887 Length:583 Species:Mus musculus

Alignment Length:649 Identity:354/650 (54%)
Similarity:453/650 (70%) Gaps:89/650 (14%)


  Fly    22 KTLNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKLYKKPES 86
            |.:||||||||||||||||..|||||||||||||:||||||||||||.||||.|||:||.||   
Mouse     3 KPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKK--- 64

  Fly    87 PAIKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKKENPLQFR 151
                                                              |..|||||||||||:
Mouse    65 --------------------------------------------------VTQQDVKKENPLQFK 79

  Fly   152 FRAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTA 216
            |||||:||||:|||||:||.|||:||||.|||.|||||||||:||||||||||::||:||..|..
Mouse    80 FRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKP 144

  Fly   217 GFLANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIR 281
            |:|||||||||||::|||::|::||:.|..|.:|||.|||||:|||||||||||||||||||||:
Mouse   145 GYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIK 209

  Fly   282 NKKGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRV 346
            |||||:||||||||||||||.||:|||||||||||||||||::|||:|||||||||||:|:|||:
Mouse   210 NKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRL 274

  Fly   347 RINKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQER-------EKLQLALAARER 404
            ||||||||||||||||||||||||||:||||||||||||:.||.||       :|.::|...:||
Mouse   275 RINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKER 339

  Fly   405 AEKKQQEYEDRLKQMQEDMERSQRDLLEAQDMIRRLEEQLKQLQAAKDELELRQKELQAMLQRLE 469
            .|::::|..:||:|::|...::|::|   ::..|:..|..::.|.||:|.|...:|.:|    .|
Mouse   340 IEREKEELMERLRQIEEQTVKAQKEL---EEQTRKALELEQERQRAKEEAERLDRERRA----AE 397

  Fly   470 EAKN---MEAVEKLKLEEEIMAKQME----VQRIQDEVNAKDEETKRLQDEV----EDARRKQVI 523
            |||:   .:|.:::|.:|::.|:..|    :..:::....|:||....|.:.    ||..:.:  
Mouse   398 EAKSAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTK-- 460

  Fly   524 AAEAAAALLAASTTPQHHHVAEDENENEEELTNGDAGGDVSRDLDTD---EHIKDPIEDRRTLAE 585
             .|....:.|....|....:...|||::|:..|   ..:.|.:|.::   .|..:  |:|.|..:
Mouse   461 -EELKTVMSAPPPPPPPPVIPPTENEHDEQDEN---SAEASAELSSEGVMNHRSE--EERVTETQ 519

  Fly   586 RNERLHDQLKALKQDLAQSRDETKETANDKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFENM 649
            :|||:..||:||..:|||:|||||:|.||.:|.|||:.|||||||||:||:||||:|:|:||.|
Mouse   520 KNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM 583

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 159/252 (63%)
FERM_N 28..83 CDD:286467 48/55 (87%)
FERM_M 163..278 CDD:278785 87/115 (76%)
FERM_C_ERM 272..368 CDD:270015 86/96 (90%)
GBP_C <375..497 CDD:303769 45/136 (33%)
ERM 403..649 CDD:279153 89/260 (34%)
coiled coil 464..477 CDD:293879 5/16 (31%)
coiled coil 486..497 CDD:293879 2/15 (13%)
RdxNP_001098086.1 B41 7..206 CDD:214604 159/252 (63%)
Phosphatidylinositol binding 60..63 2/3 (67%)
FERM_C_ERM 200..296 CDD:270015 86/96 (90%)
ERM 347..583 CDD:307079 85/251 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C72857760
eggNOG 1 0.900 E1_KOG3529
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 686 1.000 Inparanoid score I694
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001007
OrthoInspector 1 1.000 T615747
orthoMCL 1 0.900 OOG5_129438
Panther 1 1.100 LDO PTHR23281
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4666
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.