DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and erm-1

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:NP_491560.1 Gene:erm-1 WormBaseID:WBGene00001333 Length:564 Species:Caenorhabditis elegans

Alignment Length:636 Identity:341/637 (54%)
Similarity:439/637 (69%) Gaps:88/637 (14%)


  Fly    24 LNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKLYKKPESPA 88
            :|||||:||:||||||||:||||||||||||||||||:|:|||||||:||..||:||.||     
 Worm     7 INVRVTSMDSELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQYTDNKGFPTWLKLNKK----- 66

  Fly    89 IKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKKENPLQFRFR 153
                                                            |::|||||:..|.|:||
 Worm    67 ------------------------------------------------VLSQDVKKDPTLVFKFR 83

  Fly   154 AKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTAGF 218
            |||||||||||:|||:|:||||||||:.||:|||||||||||||||||:||::||:...||.||.
 Worm    84 AKFYPEDVAEEIIQDVTMRLFYLQVKDGILSDEIYCPPETSVLLASYAMQAKYGDYVPETHVAGC 148

  Fly   219 LANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIRNK 283
            |..||||||||:.|.|::.:|||:.|||||.:||:..||.||:||||||||||||||||||||||
 Worm   149 LTADRLLPQRVLGQFKLNSEEWERRIMTWWADHRATTREQAMLEYLKIAQDLEMYGVNYFEIRNK 213

  Fly   284 KGTDLWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRVRI 348
            |||||:|||||||||||::.|||:||:||||||||||||::|||:||||||||.||:|:|||:||
 Worm   214 KGTDLYLGVDALGLNIYDKADRLSPKVGFPWSEIRNISFNDKKFVIKPIDKKAHDFVFYAPRLRI 278

  Fly   349 NKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALAARERAEKKQQEYE 413
            ||||||||||||||||||||||||:|||||.||||::..|..|:|||...::|||.||::|::.|
 Worm   279 NKRILALCMGNHELYMRRRKPDTIEVQQMKQQAREDRALKIAEQEKLTREMSAREEAEQRQRDAE 343

  Fly   414 DRLKQMQEDMERSQRDLLEAQDMIRRLEEQLKQLQAAKDELELRQKELQAMLQRLEEAKNMEAVE 478
            .|:.||||||||::.:|.||.:.|..||.||||||.||..||.::.||:.:..:|:..|.|...|
 Worm   344 KRMAQMQEDMERARLELAEAHNTIHSLEAQLKQLQLAKQALEQKEYELRELTAQLQSEKAMSDGE 408

  Fly   479 KLKLEEEIMAKQMEVQRIQDEVNAKDEETKRLQDEVEDARRKQVIAAEAAAALLAASTTPQHHHV 543
            :..|.:::.|::.||..:::||..:...|::||.::...:..|..:              ..|||
 Worm   409 RRHLRDQVDAREREVFSMREEVERQTTVTRQLQTQIHSQQHTQHYS--------------NSHHV 459

  Fly   544 A----------EDENENEEELTNGDAGGDVSRDLDTDEHIKDPIEDRRTLAERNERLHDQLKALK 598
            :          :||:....||||           |.|:::.....:|.|.||:|.::.::|..|.
 Worm   460 SNGHAHDETATDDEDNGATELTN-----------DADQNVPQHELERVTAAEKNIQIKNKLDMLT 513

  Fly   599 QDLAQSRDETKETANDKIHRENVRQGRDKYKTLREIRKGNTKRRVDQFENM 649
            ::|...:|:...|..|.:|.||.:.|||||||||:||.||||||:||:|||
 Worm   514 RELDSVKDQNAVTDYDVLHMENKKAGRDKYKTLRQIRGGNTKRRIDQYENM 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 149/252 (59%)
FERM_N 28..83 CDD:286467 45/55 (82%)
FERM_M 163..278 CDD:278785 82/115 (71%)
FERM_C_ERM 272..368 CDD:270015 83/96 (86%)
GBP_C <375..497 CDD:303769 55/122 (45%)
ERM 403..649 CDD:279153 92/256 (36%)
coiled coil 464..477 CDD:293879 3/13 (23%)
coiled coil 486..497 CDD:293879 3/11 (27%)
erm-1NP_491560.1 B41 9..208 CDD:214604 149/252 (59%)
FERM_N 15..73 CDD:286467 47/111 (42%)
FERM_M 93..208 CDD:278785 82/115 (71%)
FERM_C_ERM 202..298 CDD:270015 83/96 (86%)
ERM 333..564 CDD:279153 92/256 (36%)
HMMR_C 333..456 CDD:292530 46/137 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3529
Hieranoid 1 1.000
Homologene 1 1.000 H1833
Inparanoid 1 1.050 677 1.000 Inparanoid score I366
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D281811at33208
OrthoFinder 1 1.000 FOG0001007
OrthoInspector 1 1.000 T474996
orthoMCL 1 0.900 OOG5_129438
Panther 1 1.100 LDO PTHR23281
Phylome 1 0.910 0.690 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4666
TreeFam 1 0.960
1312.870

Return to query results.
Submit another query.