DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and frmd4b

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_002940561.2 Gene:frmd4b XenbaseID:XB-GENE-958639 Length:1024 Species:Xenopus tropicalis

Alignment Length:669 Identity:140/670 (21%)
Similarity:262/670 (39%) Gaps:160/670 (24%)


  Fly    32 DAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIKLYKKPESPAIKTIKYLK 96
            |.|||..:|.....::|.|.|.....|:|..:||:.:.|..|...|::|                
 Frog    68 DRELELLVQPKLLSRELLDLVASHFSLKEKEYFGISFLDDTGQYAWLQL---------------- 116

  Fly    97 RVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKKENPLQFRFRAKFYPEDV 161
                  |::..|.:                    .|          ||..|:...|..:||.|.:
 Frog   117 ------DQRVLDHD--------------------FP----------KKSGPVSLYFVVRFYIESI 145

  Fly   162 AEELIQDI-TLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDHNKTTHTAGFLANDRLL 225
            .  .::|| |:.||:|..|..:....|....||...||:..:|...||::...:....|.....|
 Frog   146 T--FLKDITTVELFFLNAKACVFKGLIEVDSETIFKLAALILQEARGDYSSDENARKDLKILPAL 208

  Fly   226 PQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKGTDLWL 290
            |.|.:.:|. |....|..::...::.:.:.|..|::.|:||.:.|..|||:|:::::|:|...||
 Frog   209 PTRALQEHP-SLSYCEDRVIEHCKKLKGVTRGQAIVRYMKIVEALPTYGVHYYKVKDKQGIPWWL 272

  Fly   291 GVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAPDFMFFAPRVRINKR---- 351
            |:...|:..|:..|::.|:..|.|.::.|:.|.||||.::..|.:         |:.:::|    
 Frog   273 GISFKGIGQYDIQDKIKPRKLFQWKQLENLYFREKKFAVEVHDPR---------RISVSRRTFGQ 328

  Fly   352 -----------------ILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQEREKLQLAL 399
                             |..:.:..|:.|:.|:        |.||:.   .:||..:...::|..
 Frog   329 SSLVVQTWYASNSLIKSIWVMAISQHQFYLDRK--------QSKAK
I---PSAKSLDDIAMELTE 382

  Fly   400 AARERAEKKQQ--------EYEDRLKQMQEDMERSQRDLLEAQDMIRRLEEQLKQLQAAK-DELE 455
            |...:..:..:        .....:....:|.|.|:...:|....:::.||.|:.:...| :||:
 Frog   383 AGTTKVARIVEGKNPLIMASSGSLISSGSQDSEISEEQRMEKIQELKKKEEALQNILLKKIEELK 447

  Fly   456 ---LRQKELQAMLQRL------EEAKN----MEAVEKL-------------KLEEEIMAKQMEVQ 494
               ||:.||...|...      |:..|    |.|..||             :||.:.:.:|..|:
 Frog   448 KICLREAELTGKLPTEYPLNPGEKPPNVRRRMGATFKLNDILHTDEDPALQELERKFLIQQQLVE 512

  Fly   495 ---RIQDEVN-AKDEETKRLQDEVEDARRKQVIAAEAAAALLAASTTP--QHHHVAEDENENEEE 553
               ::..|.: :|:.:.||.||..:..::.|.:.:......:.:..||  :...:.:|:....|.
 Frog   513 ATKKLATEPDLSKNVKRKRKQDYSDSIKKLQELESTINEFRVKSGKTPTKRASMILQDDIIPSET 577

  Fly   554 LTNGDAGGDVSRDLDTDEHIKDPIEDRRTLAERNERLHDQ-----LKALKQD--LAQSRDETKET 611
            .:..|.               ..:||..:...:.:|||:.     .|::..|  ||:.....::.
 Frog   578 SSLSDT---------------TTLEDDESQLPQGQRLHNSPNVHLTKSIGGDKSLARKFSLNEQL 627

  Fly   612 ANDKIHRENVRQGRDKYKT 630
            :..::.||........|||
 Frog   628 SEMRVTREPSSTHSSPYKT 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 58/247 (23%)
FERM_N 28..83 CDD:286467 16/51 (31%)
FERM_M 163..278 CDD:278785 32/116 (28%)
FERM_C_ERM 272..368 CDD:270015 28/117 (24%)
GBP_C <375..497 CDD:303769 32/160 (20%)
ERM 403..649 CDD:279153 51/277 (18%)
coiled coil 464..477 CDD:293879 5/23 (22%)
coiled coil 486..497 CDD:293879 2/14 (14%)
frmd4bXP_002940561.2 B41 60..260 CDD:214604 58/247 (23%)
FERM_N 75..124 CDD:286467 14/71 (20%)
FERM_M 148..260 CDD:278785 32/113 (28%)
FERM_C_FRMD4A_FRMD4B 256..366 CDD:270012 30/127 (24%)
DUF3338 412..526 CDD:288652 27/114 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.