DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Moe and LOC100485014

Sequence 1:NP_727290.1 Gene:Moe FlyBaseID:FBgn0011661 Length:649 Species:Drosophila melanogaster
Sequence 2:XP_012812993.1 Gene:LOC100485014 ID: Length:635 Species:Xenopus tropicalis

Alignment Length:649 Identity:221/650 (34%)
Similarity:352/650 (54%) Gaps:99/650 (15%)


  Fly    16 GVSVKR-KTLNVRVTTMDAELEFAIQSTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDSTWIK 79
            |::.|: |...|::.|||:|:|...:....|..||....:|:||:|.||||||:| |.|..||:|
 Frog     5 GLTRKQLKNFRVKIMTMDSEMELTCEMNWKGSVLFGLACETLGLKESWFFGLQFT-SNGMDTWLK 68

  Fly    80 LYKKPESPAIKTIKYLKRVKKYVDKKTADSNGVNHLETSEEDDDADDMTGSMPFSTWVMNQDVKK 144
            |.||                                                     ::.||:.|
 Frog    69 LDKK-----------------------------------------------------ILQQDLPK 80

  Fly   145 ENPLQFRFRAKFYPEDVAEELIQDITLRLFYLQVKNAILTDEIYCPPETSVLLASYAVQARHGDH 209
            |.|.:|||.||||||:|||||:||||..||:||||..||.:||:|.||.|||||.:|:||::||:
 Frog    81 EEPTKFRFLAKFYPENVAEELVQDITRHLFFLQVKKQILDEEIHCLPEASVLLALFALQAKYGDY 145

  Fly   210 NKTTHTAGFLANDRLLPQRVIDQHKMSKDEWEQSIMTWWQEHRSMLREDAMMEYLKIAQDLEMYG 274
            |...|..|||:.|.||||||:.|::|:.:.|::.|..|:.|||...|::|.|.||||||||:|:|
 Frog   146 NPNIHQPGFLSKDELLPQRVLQQYQMTSEMWQEKITAWYAEHRGTDRDEAEMNYLKIAQDLDMFG 210

  Fly   275 VNYFEIRNKKGTD--LWLGVDALGLNIYEQDDRLTPKIGFPWSEIRNISFSEKKFIIKPIDKKAP 337
            :|||.| ::..||  :.|||:|.|::|:..::::.|...|.|.:||||:::.||..|.||.:|..
 Frog   211 MNYFPI-SQSNTDSNILLGVNAKGIHIFSINNKIIPLKSFKWGDIRNINYNYKKLKIIPISRKED 274

  Fly   338 DFMFFAPRVRINKRILALCMGNHELYMRRRKPDTIDVQQMKAQAREEKNAKQQEREKLQLALAAR 402
            .|.|::...:::|.|..||.|||.|:|.:||.|:.|:||||.||:.|:..|:.|.:.|......|
 Frog   275 VFKFYSSGHKVDKLIYDLCTGNHRLFMTKRKVDSKDIQQMKNQAKLERTRKKIEHQNLLREKQLR 339

  Fly   403 ERAEKKQQEYEDRLKQMQEDMERSQRDLL---EAQDMIRR----LEEQLKQLQAAKDELELRQKE 460
            |.||:.:::.|.||.|::::..::...|:   |..:::..    .||:.|.|  |::.:|.||: 
 Frog   340 EDAERAKEDMERRLFQLEDEARQANEALICSNETAELMAEKAQIAEEEAKLL--AQNAVETRQE- 401

  Fly   461 LQAMLQRLEEAKNMEAVEKLKLEEEIM--AKQMEVQRIQDEVNAKDEETKRLQDEVEDAR----- 518
                :||| |...:::.|:::|.|:.|  |..:.|:.|: |.:.:.:|.::|:.::..||     
 Frog   402 ----MQRL-EISVLKSKEEMQLMEQKMREADMITVKLIK-ESDRRAKEAEQLEQDLRKAREAERN 460

  Fly   519 -RKQVIAAEAAAALLAASTTPQHHHVAEDENEN--EEELTNGDAGGDVSRDLDTD-EHIKDPIE- 578
             :::::...:....|||...|.      |..:.  |..:.:.||.       ||| :.:...|| 
 Frog   461 AKQRLMDVSSLCQPLAAKCFPL------DVTDGFIENRIISLDAS-------DTDIKRLSLEIEK 512

  Fly   579 DRRTLAERNERLHDQLKALKQDLAQSRDETKETANDKIHRENVRQGRDKYKTLREIRKGNTKRR 642
            :|....|::.:|..||..||.:|...:.|.::.:...:....:|.....:..|.....|...||
 Frog   513 ERLDYLEKSRQLESQLNDLKTELRTLKREDRQLSLQSLWNGTLRSKDHLHDPLWMTTYGEQYRR 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MoeNP_727290.1 B41 26..278 CDD:214604 109/252 (43%)
FERM_N 28..83 CDD:286467 26/55 (47%)
FERM_M 163..278 CDD:278785 65/115 (57%)
FERM_C_ERM 272..368 CDD:270015 39/98 (40%)
GBP_C <375..497 CDD:303769 39/131 (30%)
ERM 403..649 CDD:279153 60/260 (23%)
coiled coil 464..477 CDD:293879 4/13 (31%)
coiled coil 486..497 CDD:293879 4/13 (31%)
LOC100485014XP_012812993.1 B41 15..214 CDD:214604 109/253 (43%)
FERM_N 22..77 CDD:286467 26/109 (24%)
FERM_M 99..214 CDD:278785 65/115 (57%)
PH-like 208..305 CDD:302622 39/98 (40%)
ERM 340..544 CDD:279153 55/226 (24%)
GBP_C <344..473 CDD:303769 30/138 (22%)
coiled coil 454..465 CDD:293879 2/11 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D281811at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.