DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32638 and AGTRAP

Sequence 1:NP_727668.2 Gene:CG32638 FlyBaseID:FBgn0052638 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_011540102.1 Gene:AGTRAP HGNCID:13539 Length:171 Species:Homo sapiens

Alignment Length:161 Identity:48/162 (30%)
Similarity:79/162 (49%) Gaps:17/162 (10%)


  Fly     8 MGSPFVRVKLVA------FVHFFFISNAMLGSWG----HGAYEFYNFLFLIAMFWSMHSKDSVEA 62
            |..|.|.:|..:      ..|...:.:.:|.:||    .|:|.:.||..|....|::..:||::|
Human     1 MELPAVNLKCASSSVPRNHPHVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDA 65

  Fly    63 IQTALVINASSIFFDIVSISLHFGIMN-----GWAVAFSIINLILRPVSVALLYKEFNTRGGTLP 122
            |...|....::||.|||.||:.:..::     .:.|..:|::|:|:|:|...:|..:..|||.|.
Human    66 ISMFLGGLLATIFLDIVHISIFYPRVSLTDTGRFGVGMAILSLLLKPLSCCFVYHMYRERGGELL 130

  Fly   123 TGSVF-PTSQQRS-YQDIDRPTQPTPTNSQP 151
            ..:.| .:||.|| ||.||....|....:.|
Human   131 VHTGFLGSSQDRSAYQTIDSAEAPADPFAVP 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32638NP_727668.2 AGTRAP 8..159 CDD:197883 48/162 (30%)
AGTRAPXP_011540102.1 AGTRAP 22..164 CDD:283939 43/141 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214311361
eggNOG 1 0.900 E1_2C9HK
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5272
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1325275at2759
OrthoFinder 1 1.000 FOG0007941
OrthoInspector 1 1.000 T1073270
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16521
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5209
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.