DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32638 and agtrap

Sequence 1:NP_727668.2 Gene:CG32638 FlyBaseID:FBgn0052638 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001015751.1 Gene:agtrap XenbaseID:XB-GENE-482876 Length:163 Species:Xenopus tropicalis

Alignment Length:157 Identity:39/158 (25%)
Similarity:70/158 (44%) Gaps:14/158 (9%)


  Fly     8 MGSPFVRVKLVAFVHFFFISNAMLGSWGHGAYEFYNFLFLIAMFWSMHSKDSVEAIQTALVINAS 72
            |..|.|.:|.:.|.|:.....|.:..|...||...|...|....|::..:||::||...|:....
 Frog     1 MELPAVNLKAIVFTHWLLTVFACMIDWLPKAYGLANITILAMGVWAIAQRDSIDAIFMFLIGLLL 65

  Fly    73 SIFFDIVSISLHF---------GIMNG---WAVAFSIINLILRPVSVALLYKEFNTRGGT--LPT 123
            :|..||:..:|:|         |.:..   ::....|.:|:|:|:|...:|..:..|||.  :..
 Frog    66 TILTDILLFALYFTEAEKASESGPLRDLFRFSSGMGIFSLLLKPLSCFFMYHMYRERGGEYFVNL 130

  Fly   124 GSVFPTSQQRSYQDIDRPTQPTPTNSQ 150
            |.:..:..:.|||.|:....|...:::
 Frog   131 GFITLSRDRSSYQSIEHMDPPADQDNK 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32638NP_727668.2 AGTRAP 8..159 CDD:197883 39/158 (25%)
agtrapNP_001015751.1 AGTRAP 1..163 CDD:197883 39/158 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214308368
eggNOG 1 0.900 E1_2C9HK
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5153
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1325275at2759
OrthoFinder 1 1.000 FOG0007941
OrthoInspector 1 1.000 T1059359
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5209
TreeFam 1 0.960
109.790

Return to query results.
Submit another query.