DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32638 and Agtrap

Sequence 1:NP_727668.2 Gene:CG32638 FlyBaseID:FBgn0052638 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001007655.1 Gene:Agtrap RGDID:1359346 Length:160 Species:Rattus norvegicus

Alignment Length:148 Identity:48/149 (32%)
Similarity:75/149 (50%) Gaps:17/149 (11%)


  Fly     8 MGSPFVRVKLVAFVHFFFISNAMLGSWG----HGAYEFYNFLFLIAMFWSMHSKDSVEAIQTALV 68
            |..|.|.:|::..||:      :|.:||    .|:|.:.||..|....|::..:|||:||...|.
  Rat     1 MELPAVNLKVILLVHW------LLTTWGCLAFSGSYAWGNFTILALGVWAVAQRDSVDAIGMFLG 59

  Fly    69 INASSIFFDIVSISLHF-----GIMNGWAVAFSIINLILRPVSVALLYKEFNTRGGTLPTGSVF- 127
            ...::||.||:.||:.:     |....::...:|.:|:|:|.|..|:|.....|||.||..|.| 
  Rat    60 GLVATIFLDIIYISIFYSSVAVGDTGRFSAGMAIFSLLLKPFSCCLVYHMHRERGGELPLRSDFF 124

  Fly   128 -PTSQQRSYQDIDRPTQP 144
             |:.:..:||.||....|
  Rat   125 GPSQEHSAYQTIDSSDSP 142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32638NP_727668.2 AGTRAP 8..159 CDD:197883 48/149 (32%)
AgtrapNP_001007655.1 AGTRAP 1..160 CDD:197883 48/149 (32%)
Interaction with AGTR1. {ECO:0000250} 110..122 6/12 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214312102
eggNOG 1 0.900 E1_2C9HK
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5126
OMA 1 1.010
OrthoDB 1 1.010 D1325275at2759
OrthoFinder 1 1.000 FOG0007941
OrthoInspector 1 1.000 T1086909
orthoMCL 1 0.900 OOG5_136823
Panther 1 1.100 LDO PTHR16521
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.