DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32638 and Agtrap

Sequence 1:NP_727668.2 Gene:CG32638 FlyBaseID:FBgn0052638 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_033772.2 Gene:Agtrap MGIID:1339977 Length:161 Species:Mus musculus

Alignment Length:143 Identity:44/144 (31%)
Similarity:72/144 (50%) Gaps:17/144 (12%)


  Fly     8 MGSPFVRVKLVAFVHFFFISNAMLGSWG----HGAYEFYNFLFLIAMFWSMHSKDSVEAIQTALV 68
            |..|.|.:|::..||:      :|.:||    ..:|.:.||..|....|::..:||::||...|.
Mouse     1 MELPAVNLKVILLVHW------LLTTWGCLVFSSSYAWGNFTILALGVWAVAQRDSIDAIGMFLG 59

  Fly    69 INASSIFFDIVSISLHF-----GIMNGWAVAFSIINLILRPVSVALLYKEFNTRGGTLPTGSVF- 127
            ...::||.||:.||:.:     |....:....:|::|:|:|.|..|:|.....|||.||....| 
Mouse    60 GLVATIFLDIIYISIFYSSVATGDTGRFGAGMAILSLLLKPFSCCLVYHMHRERGGELPLRPDFF 124

  Fly   128 -PTSQQRSYQDID 139
             |:.:..:||.||
Mouse   125 GPSQEHSAYQTID 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32638NP_727668.2 AGTRAP 8..159 CDD:197883 44/144 (31%)
AgtrapNP_033772.2 AGTRAP 1..161 CDD:197883 44/144 (31%)
Interaction with AGTR1. {ECO:0000250} 110..122 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214312037
eggNOG 1 0.900 E1_2C9HK
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5309
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007941
OrthoInspector 1 1.000 T1083352
orthoMCL 1 0.900 OOG5_136823
Panther 1 1.100 LDO PTHR16521
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5209
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.