DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34120 and CG3164

DIOPT Version :8

Sequence 1:NP_001285513.1 Gene:CG34120 / 318066 FlyBaseID:FBgn0083956 Length:1998 Species:Drosophila melanogaster
Sequence 2:NP_722605.1 Gene:CG3164 / 33171 FlyBaseID:FBgn0025683 Length:699 Species:Drosophila melanogaster

Alignment Length:830 Identity:170/831 (20%)
Similarity:290/831 (35%) Gaps:260/831 (31%)


  Fly   783 GWGELIRMELQQEGLTVRHLIQVGPARSECAMALLMFLLDLLLYAVIGLAYQRYKKTDNYSFVKV 847
            |.|:|....:..:..|::||    |.|.         .:||..:   .|.|:  .|..|.|..|.
  Fly    20 GAGQLKAQIVPAQPKTLQHL----PKRP---------AVDLAFH---NLTYR--VKEGNRSNAKT 66

  Fly   848 SRSQLDGKLGASLVNVSKLYGSKCAVSNLSLDFARNQVSCLLGRNGAGKSTLIKLLTGQIRQS-S 911
            ....:.|:|.:                        .:::.::|.:|||||||:.:|:|....| .
  Fly    67 ILKGVSGRLRS------------------------GELTAIMGPSGAGKSTLLNILSGYKTSSIE 107

  Fly   912 GKVLLAGEHQ--------VGVCWQDNILIPTLTAREHLQLYAQIKIPPGGSGGVEEIRSEVAQTL 968
            |.|.:.|..:        .....|||.|...||.:|.:.:...:|:....|  ..|..|.:...|
  Fly   108 GSVTMNGAERNLSAFRKLSAYIMQDNQLHGNLTVQEAMTVATNLKLSKKFS--KPEKHSMIDDIL 170

  Fly   969 QSLNFGKHESYPSWQLSGGYRRRLCVAIAFIASPSVVILDEPCNGVDAKARKDIWQLIERLRQGR 1033
            .:|:..:|....:..||||.::||.:|:..:::|.::..|||.:|:|:........|::.|..|.
  Fly   171 LTLSLSEHRYTMTRNLSGGQKKRLSIALELVSNPPIMFFDEPTSGLDSSTCFQCIHLLKMLAAGG 235

  Fly  1034 AVIFATHFMDEAKY--LSDSLVIMRNGRIIAQHSR-------DSLQRLCTS-----NYSIRLRC- 1083
            ..:..|.....|:.  :.|.|..:.:|:.:.|.|.       .:|...|.|     :|.|.:.| 
  Fly   236 RTVICTIHQPSARLFEMFDQLYTLADGQCVYQGSTKQLVPFLSTLNLECPSYHNPASYVIEVSCG 300

  Fly  1084 -----------------------ADATGV-----TFVIQKAQQLLPQTQVTHSGAADYPHSLTIN 1120
                                   ||..|:     ...:|..:.:|.:...:......|..:||:|
  Fly   301 EHGDHTRKLVDAIDNGKRDVRSSADYAGLKARNDLVKVQNLKAILDKNDASSVSGRKYEDNLTLN 365

  Fly  1121 ASYAEHLTPGAVEFLELLQSQVTAGSISDVELTTSSSLEQEFEQLNRNGE---DAGPRRPASDRS 1182
                ..|..|.|..:      |..|::|...:||           |..|:   |.        ..
  Fly   366 ----NGLLNGMVNDI------VKEGNVSSALVTT-----------NERGDAMIDV--------EK 401

  Fly  1183 GVVAGPAMITDE-------PPTACKQFRLLMGKRLRHLSRNYRL--------LLYVLLLPALFEL 1232
            .|....|::|:|       |.:...||.:::.:.|....|::.|        ||...|:.||:  
  Fly   402 SVNCTTALLTEEITSPERYPTSQFHQFWVVLKRTLLFSYRDWTLMYLRLFAHLLVGFLIGALY-- 464

  Fly  1233 CAMWFVSYRLEDDFDTVLPLSRSLYPQTAQFLSHERAT----SFSEKLYPQLRTSCDHLGECRVF 1293
                   |.:.:|...||.....|: ....||.:...|    ||..::...|:.:         |
  Fly   465 -------YDIGNDGAKVLSNLGFLF-FNMLFLMYTSMTITILSFPLEMPVLLKEN---------F 512

  Fly  1294 NTSQQSYDWVLNSWGEYSERRYGGYGLNGSGATVWYNNKGYHSMMAWLNDLNSELLRTTMNDSES 1358
            |.                                ||:.|.|:..:: :.||..:.:...:..|..
  Fly   513 NR--------------------------------WYSLKSYYLAIS-VADLPFQAIFCVIYVSIV 544

  Fly  1359 SILTLNEPWKLGFAELSTSSILRQAGDGSMVFILLIAF-----GLVVASGSVYLVNERVNGEKLQ 1418
            ...| ::||     ||...|:...|       .|||:|     ||||  |:...|...|      
  Fly   545 YYFT-SQPW-----ELFRFSMFLSA-------CLLISFVAQSVGLVV--GAAMNVQNGV------ 588

  Fly  1419 QRLCGVSAVTYWLVA---LVWDYLVMVLGLIVCLVVILMFGMPVFVDRQQLVGIIGLSLA----- 1475
             .|..|.:|.:.|.:   :.:|.:.:.|..|..|..|             ..|..|.:||     
  Fly   589 -FLAPVMSVPFLLFSGFFVSFDAIPVYLRWITYLSYI-------------RYGFEGTALATYGYG 639

  Fly  1476 ------FSFACVPSVHVAEKIFSDSSIAIVSIFCANLIVPLVTMGIILIL 1519
                  |...|    |....|.:...:.:|:   ||..:.:|.:.:|.::
  Fly   640 REKLRCFQTYC----HFKSPITTLEELDMVN---ANFTLDIVALIVIFVV 682

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34120NP_001285513.1 ABC2_membrane_3 <621..760 CDD:289468
ABC_subfamily_A 859..1073 CDD:213230 52/232 (22%)
drrA 865..1162 CDD:130256 74/349 (21%)
ABC2_membrane_3 1230..1601 CDD:289468 60/314 (19%)
Mem_trans 1436..>1552 CDD:304621 18/96 (19%)
ABC_subfamily_A 1651..1857 CDD:213230
drrA 1666..1945 CDD:130256
CG3164NP_722605.1 ABCG_EPDR 44..268 CDD:213180 60/255 (24%)
3a01204 60..699 CDD:273361 157/773 (20%)
ABC2_membrane 431..630 CDD:279410 56/286 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.