DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34120 and Abcg5

DIOPT Version :8

Sequence 1:NP_001285513.1 Gene:CG34120 / 318066 FlyBaseID:FBgn0083956 Length:1998 Species:Drosophila melanogaster
Sequence 2:NP_114090.1 Gene:Abcg5 / 27409 MGIID:1351659 Length:652 Species:Mus musculus

Alignment Length:714 Identity:147/715 (21%)
Similarity:259/715 (36%) Gaps:206/715 (29%)


  Fly   873 VSNLSLDFARNQVSCLLGRNGAGKSTLIKLLTGQIRQS---SGKVLLAG----EHQVGVCW---- 926
            :.::||.....|:.|:||.:|:||:||:..::|::|::   .|:|.:.|    ..|...|:    
Mouse    70 LKDVSLYIESGQIMCILGSSGSGKTTLLDAISGRLRRTGTLEGEVFVNGCELRRDQFQDCFSYVL 134

  Fly   927 QDNILIPTLTAREHLQLYAQIKIPPGGSG----GVEEIRSEVA------QTLQSLNFGKHESYPS 981
            |.::.:.:||.||.|:..|.:.:....:.    .||.:.:|::      |.:.|.|||       
Mouse   135 QSDVFLSSLTVRETLRYTAMLALCRSSADFYNKKVEAVMTELSLSHVADQMIGSYNFG------- 192

  Fly   982 WQLSGGYRRRLCVAIAFIASPSVVILDEPCNGVDAKARKDIWQLIERL-RQGRAVIFATHF-MDE 1044
             .:|.|.|||:.:|...:..|.|::||||..|:|......|..|:..| |:.|.||...|. ..|
Mouse   193 -GISSGERRRVSIAAQLLQDPKVMMLDEPTTGLDCMTANQIVLLLAELARRDRIVIVTIHQPRSE 256

  Fly  1045 AKYLSDSLVIMRNGRIIAQHSRDSLQRLCTSNYSIRLRCADATGVTFVIQKAQQLLPQTQVTHSG 1109
            .....|.:.|:..|.::.                    |.....:...........|:    ||.
Mouse   257 LFQHFDKIAILTYGELVF--------------------CGTPEEMLGFFNNCGYPCPE----HSN 297

  Fly  1110 AADYPHSLT-INASYAEHLTPGAVEFLELLQSQVTAGSISDVELTTSSSLEQEFEQLNRNGEDAG 1173
            ..|:...|| ::....|.    .:|..:.:|....|...||:           :.::..|.|.|.
Mouse   298 PFDFYMDLTSVDTQSRER----EIETYKRVQMLECAFKESDI-----------YHKILENIERAR 347

  Fly  1174 -----PRRPASDRSGVVAGPAMITDEPPTACKQFRLLMGKRLRHLSRNYRLLLYVL---LLPALF 1230
                 |..|..            |.:||....:..:|:.:..|:|.||.:.::..|   |:..||
Mouse   348 YLKTLPTVPFK------------TKDPPGMFGKLGVLLRRVTRNLMRNKQAVIMRLVQNLIMGLF 400

  Fly  1231 ELCAMWFVSYRLEDDFDTVLPLSRSLYPQTAQFLSHERATSF-----SEKLYPQLRTSCDHLGEC 1290
                :.|...|::::     .|..::..:.........||.:     :..|:|.||...|     
Mouse   401 ----LIFYLLRVQNN-----TLKGAVQDRVGLLYQLVGATPYTGMLNAVNLFPMLRAVSD----- 451

  Fly  1291 RVFNTSQQSYDWVLNSWGEYSERRYGGYGLN----GSGATVWYNNKGYHSMMAWLNDLNSELLRT 1351
                  |:|.|.:.:.|     :....|.|:    ...|||.:::..|     |...|..|:.| 
Mouse   452 ------QESQDGLYHKW-----QMLLAYVLHVLPFSVIATVIFSSVCY-----WTLGLYPEVAR- 499

  Fly  1352 TMNDSESSILTLNEPWKLG-FAELSTSSILRQAGDGSMVFILLIAFGLVVASGSVYLVNE----- 1410
             .....:::|.   |..:| |..|....|::.....:.:..||...||::.||.:..:.|     
Mouse   500 -FGYFSAALLA---PHLIGEFLTLVLLGIVQNPNIVNSIVALLSISGLLIGSGFIRNIQEMPIPL 560

  Fly  1411 RVNGEKLQQRLCGVSAVTYWLVALVWDYLVMVLGLIVC--LVVILMFGMPVFVDRQQLVGIIGLS 1473
            ::.|....|:.|                         |  |||...:|:                
Mouse   561 KILGYFTFQKYC-------------------------CEILVVNEFYGL---------------- 584

  Fly  1474 LAFSFAC---------------VPSVHVAEKIFSDSSIAIVSIFCANLIVPLVTMGIILILGVV 1522
               :|.|               ...|...||....::    |.|.||.::....:..::|||:|
Mouse   585 ---NFTCGGSNTSMLNHPMCAITQGVQFIEKTCPGAT----SRFTANFLILYGFIPALVILGIV 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34120NP_001285513.1 ABC2_membrane_3 <621..760 CDD:289468
ABC_subfamily_A 859..1073 CDD:213230 59/223 (26%)
drrA 865..1162 CDD:130256 72/313 (23%)
ABC2_membrane_3 1230..1601 CDD:289468 59/326 (18%)
Mem_trans 1436..>1552 CDD:304621 18/105 (17%)
ABC_subfamily_A 1651..1857 CDD:213230
drrA 1666..1945 CDD:130256
Abcg5NP_114090.1 ABCG_White 50..276 CDD:213201 60/234 (26%)
3a01204 61..646 CDD:273361 147/715 (21%)
ABC2_membrane 372..579 CDD:279410 53/267 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.