DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34120 and LOC108648810

DIOPT Version :8

Sequence 1:NP_001285513.1 Gene:CG34120 / 318066 FlyBaseID:FBgn0083956 Length:1998 Species:Drosophila melanogaster
Sequence 2:XP_017952770.1 Gene:LOC108648810 / 108648810 -ID:- Length:2624 Species:Xenopus tropicalis

Alignment Length:1903 Identity:339/1904 (18%)
Similarity:590/1904 (31%) Gaps:692/1904 (36%)


  Fly   311 LHTNATFQEAFDNLLKLAKSPLVKSLV---GDDFDIGEIERVFEYIRTNQLIYDILTTVADLMDC 372
            |||..|.|...:....|..:.::.|:.   |.|    :|..:...:....|..|||...|.|::.
 Frog    17 LHTENTTQVLLETWKILHVTQILFSMSEQNGTD----QIGMLLTSLSNLNLGDDILNDTAKLVEL 77

  Fly   373 VSADRFEAVESVEELHKRAY-ELNQNK----LFLAALNL--EDVGLKQASYRLHMDTDNTQPTFE 430
            .|.  ....|.:.||....| .||.|.    |||..||:  :.|.|..||     ||:.....||
 Frog    78 FSI--INQTELITELFNTIYVALNNNSQASMLFLDTLNIFKDLVHLYNAS-----DTEELSTVFE 135

  Fly   431 NRNRFWFPGPADSMVIDLKYHRGFVQLKQMVDLGI---------IKSKREEAGFAPEEDGPE--- 483
                                    :.|:...|.||         :..:..:|....|:..|.   
 Frog   136 ------------------------IYLQNFSDAGIDLMLYFNDLLGKQSGKANNTIEQVLPYFLS 176

  Fly   484 ---SGRSLSGLFS----IKQVENDTPDEDDDDFDLSLEESGDEKAAPKVSASASDHEATTISPSS 541
               ..||::.:..    ||.:....|.:|.|.|         :|.|..........|..:..|.:
 Frog   177 SELQNRSINTINHIARLIKLMSAYVPKDDQDIF---------QKVANTTLLLIDALETCSAKPEN 232

  Fly   542 LDGVTTEEVRVTTEQTVVSGDPDLLLLKNEDVLKRSKRQGLFDLLGGFGGS----GDANKKNKFE 602
            ...:..|...:..:.|.:     :..:.|:            .|.|..|.|    .:.:.||...
 Frog   233 CSNIYEEIQYLAFDMTQI-----VAAIHNK------------SLEGHLGNSTFTYNEQSLKNVIN 280

  Fly   603 VDNMQFYTKQFPYPAFLNDVFKRGLYLAQGVQVAYLLGLVVFVALSVRERIWMRESRNSMLMRSM 667
            ..::.:|.:..|     ||..:..|.|.:..             |:||..|.....||.:     
 Frog   281 DISLIWYAQGQP-----NDTAETPLKLFEEF-------------LAVRSLIQNTTLRNDL----- 322

  Fly   668 GLKAHSELVAWALMSFLELCVIFALISGVLYSGGILGYTNWF--FMMFYCLSFGLCLISFCYMCT 730
                 :..::..|.:.||          ||.|..|..|....  .:|..|::......|.|    
 Frog   323 -----NVTISPPLQNILE----------VLTSSNISEYLYQIQNVLMSNCINQEDTDPSVC---- 368

  Fly   731 NFFNSANIGAVASALLFFISLCPF-------IIVLMFDAKL---SVFESF-----LVDLSFTTAF 780
                  |:. :||.|...::|.|.       :.||:...:|   ::.||.     ||||...|.|
 Frog   369 ------NLN-LASKLAHLLNLLPLTEAAHDRLSVLISITELWLNTINESIPADQQLVDLYNVTMF 426

  Fly   781 AKGWGELIRMELQQEGLTVRHLIQVGPARSECAMALLMFLLDLLLYAVIGLA---YQRYKKTDNY 842
            |.                 :|                    .|||||:...|   .|..::|.:.
 Frog   427 AS-----------------KH--------------------RLLLYAINRAAENILQLLQETKSV 454

  Fly   843 SF--VKVSRSQLDGKLGASLVNVSKLYGSKCAVSNLSLDFARNQVSCLLGRNGAGKSTLIKLLTG 905
            ||  .|...:.|...|.....:|:|...|....||:|....          |...:|.::..|..
 Frog   455 SFNGTKTITTLLSSILKVIAFDVNKFNLSNVLQSNISDSLV----------NIRRQSDIVLWLMS 509

  Fly   906 QIRQSSGKV-LLAGEH--QVGVCW-QDNILIPTLTAREHLQLYAQIKIPPGGSGGVEEIRSEVAQ 966
            |:|.::..| .|||.:  |....| .||              |..|.:          |.|....
 Frog   510 QVRNTTALVKTLAGNYTNQTAGQWITDN--------------YQYINL----------IFSNTEN 550

  Fly   967 TLQSLNFGKHESYPSWQLSGGYRRRLCVAIAFIASPSVVILDEPCNGVDAKARKDIWQLIERLRQ 1031
            .:.:||     |:.:      ::.|:         |...:.:|          .|.::||....|
 Frog   551 VIDALN-----SFST------FKDRM---------PLFNVTNE----------NDKYRLILYNVQ 585

  Fly  1032 GRAVIFATHFMDEAKYLSDSLVIMRNGRIIAQHSRDSLQRLCTSNYSIRLRCADATGVTFVIQKA 1096
            |....|:.      .||.:.|::..|           |......|         |..:.|.:   
 Frog   586 GLLQNFSN------SYLFEHLLMHEN-----------LHNTLWEN---------AIWLVFNV--- 621

  Fly  1097 QQLLPQTQVTHSGAADYPHSLTINAS-----------------YAEHLTPGAVEFLELLQSQVTA 1144
                  |::..:.|:..|..:||||:                 ..|::..|.:||.:      |.
 Frog   622 ------TELIVTEASPSPPYITINATMKILQVVFRNIQQIVLLQKENINQGLMEFWQ------TV 674

  Fly  1145 GSISDVELTTSSSLEQEFEQL--NRNGEDAGPR--RPAS---------DRSGVVAGPAMITDEPP 1196
            .::||:.|.:..:...:.|.|  :.|....||.  :.||         :::|::   :.:.:..|
 Frog   675 FNVSDIFLASGQNGTSQLETLITSVNNLSFGPNFIKDASKLAELFSIINQTGLI---SELANNLP 736

  Fly  1197 TA-----CKQFRLLMGK--------------RLRHLS-------RNY-----------RLLLYVL 1224
            .|     .:||:|.:..              .:..||       :||           .::|.||
 Frog   737 IAFQYDNIQQFKLFLNALDIFNGLVQFNNTINIHELSSVFKQYLQNYTDARNQTQDSLNMILNVL 801

  Fly  1225 L--------LP---------ALFELCAMWFVSYRLEDDFDTVLPLSRSLYPQTAQFLSHERATSF 1272
            .        ||         ||.:...:..:|....:..:|:........|:..|.: :|:..:.
 Frog   802 FYLNNLSEGLPSELDNTFMHALLQFQELTNLSSNFTNKIETLFNFISEYVPKEEQGI-YEKVANI 865

  Fly  1273 SEKLYPQLRTSCDHLGECRV-FNTSQQSYDWVLNSWGEYSERRYGGYGLNGS------------- 1323
            |..|.....|....||.|.: |...|.....:...|.....:.......|.|             
 Frog   866 SLLLIATTETCNAKLGNCTIHFEEIQHLLLDITQFWPLIQNKTAVELFTNSSLLLLDSLDQSAKT 930

  Fly  1324 -----GATVWYNNKGYHS-----MMA-----------WLNDLNSEL---LRTTMNDSESSILTLN 1364
                 .:.:.|..|  ||     |:|           |:  |||.|   |..|::.|..:||.:.
 Frog   931 LISDIISILLYTQK--HSDNSSEMVAGIFEEMLTVRNWI--LNSTLRNDLNLTISPSLQNILEIL 991

  Fly  1365 EPWKLGFAE--------LSTSSILRQAGDGSMVFILLIAFGLVVASGSVYLVNERVNGEKLQQRL 1421
            :..:....|        ::||:...|:|.|.:                                |
 Frog   992 KSHENNITEFLYQIENIVNTSNCFNQSGAGPL--------------------------------L 1024

  Fly  1422 CGVSAVTYWLVALVWDYLVMVLGLIVCLVVILMFGMPVFVDRQQLVGIIGLSLAFSFACVPS--V 1484
            |.                   |.|.:.|..:|| .:|:....:....|:. |||..:....|  |
 Frog  1025 CN-------------------LNLTLKLTQLLM-SLPLNQSAKDSFSIVS-SLAEQWLSKISNNV 1068

  Fly  1485 HVAEKI--FSDSSI-------AIVSIF--CANLIVPLVTMGIILILGVVGDGPAWDDWRHALNQA 1538
            :..::.  |.|:::       |:..|:  .|:::..|...|.:|.:.:.|...|         .|
 Frog  1069 YTYQQFIEFYDATVNASQYKTALNLIYRSVADIVQLLQETGAVLNININGTDTA---------AA 1124

  Fly  1539 FLIFPIHALGDGFLELCKNYMVALVFRRYDIDSYKHPLA-----SDLLG---------------- 1582
            .....:.|:|                  :|..:|....|     ||:|.                
 Frog  1125 LFSEMLDAVG------------------FDASNYNFSSAIQHNISDILNNIQFQLDVVQWFIIQV 1171

  Fly  1583 RHFTALLLVGVAALIINVLIEWHL-----LRRLWQRVERLLDCTYRRELDKLGQLKLVNIQSIFK 1642
            |:.|..:.....|..:..|..|.:     ::.:...:||.:|                 :.:.|.
 Frog  1172 RNQTGFISTFPGAYTMQKLAHWMIDNYQYIKVIINNIERTID-----------------VFNPFF 1219

  Fly  1643 SCVDTGEAVRAENLWLAYRRGHYAVRNVNFSVQRGECFGLLGKNGAGKSTIFKLLTGQLQPDVGQ 1707
            :..|..:.|...:....|....|.::.:..::.....||.|..|.:.:|.|::        :..|
 Frog  1220 TLTDILQIVNTTSQNEKYHLLFYRIKAILQNLTNDSFFGDLLTNKSFQSVIWQ--------NALQ 1276

  Fly  1708 IYFEQPGISYCPQS-NPLDPLLTTTECIRFYGRLRGIRDLDQFLDRVLDTY-ELRPYKDVQVRNL 1770
            :.|....:....:| ||  |.:||...::             .|..||:.: ::.|         
 Frog  1277 LVFNITDLIITEESLNP--PYITTNTTMK-------------ILQMVLENFQQIWP--------- 1317

  Fly  1771 SGGNRRKLTVAVTCCGCTPTVLMDEPTSDMDPVTRDMVYATIEQLLLARRAVV-LTSHSVSEIEH 1834
                                       ||.|.:||.:..:....|.:::..:. ...:..|::|.
 Frog  1318 ---------------------------SDNDNITRFIKESWQTVLDISKICIAPFQQNETSKLEM 1355

  Fly  1835 LCQRVAVLRAGQVIASDSPQRLKSEHGGYYAVTCFCGPAQQAILSRSLNQR--LPGARDLQHYAH 1897
            |...:..|:.|..|.:|:                    |:.|.|...:|:.  :....:..|...
 Frog  1356 LITSLNTLKFGNGIFNDT--------------------AKMAELFTIINETGLISELDNALHIVL 1400

  Fly  1898 SLRFLVRVR----------SPGSLGDAPLLSELFAILCDVCVNVARFSLSRCRFETVFERILD-- 1950
            |...:.:|:          ..|.|.:|..:.||.|:..:...:.:.|..:.   ||.|..||:  
 Frog  1401 SYDNIQKVKLFLDALEIFTGLGHLNNASNIQELSAVFRNYLQSQSDFGNNT---ETAFNLILNLL 1462

  Fly  1951 --------SSESNGSNGV 1960
                    :...:.:||:
 Frog  1463 LNLNNLIGNQSGDMNNGI 1480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34120NP_001285513.1 ABC2_membrane_3 <621..760 CDD:289468 29/148 (20%)
ABC_subfamily_A 859..1073 CDD:213230 40/218 (18%)
drrA 865..1162 CDD:130256 57/318 (18%)
ABC2_membrane_3 1230..1601 CDD:289468 74/451 (16%)
Mem_trans 1436..>1552 CDD:304621 25/129 (19%)
ABC_subfamily_A 1651..1857 CDD:213230 34/209 (16%)
drrA 1666..1945 CDD:130256 47/294 (16%)
LOC108648810XP_017952770.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D131191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.