DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34120 and abca1

DIOPT Version :8

Sequence 1:NP_001285513.1 Gene:CG34120 / 318066 FlyBaseID:FBgn0083956 Length:1998 Species:Drosophila melanogaster
Sequence 2:XP_004910916.1 Gene:abca1 / 100491942 XenbaseID:XB-GENE-1001143 Length:2311 Species:Xenopus tropicalis

Alignment Length:2498 Identity:549/2499 (22%)
Similarity:922/2499 (37%) Gaps:764/2499 (31%)


  Fly    13 LLRKDLLVRWRQKGLSLILLAWPVMVFMLLYLIRLKYGSEELEACQYPTRLLPTKNQVVPAAFSY 77
            ||.|:...|.||....::.:|||:.:|.:|..:||.|...|...|.:|.:.:|:.. .:|.....
 Frog    10 LLWKNFTYRRRQTLQLVVEVAWPLFIFFILISVRLSYPPYEQHECHFPNKAMPSAG-TLPWVQGI 73

  Fly    78 ICSIENRC--QPAHPYEE------------------------YSHWKEA---------------- 100
            ||:..|.|  .|. |.|.                        ||| |:.                
 Frog    74 ICNANNPCFRYPT-PGESPGVVGNFNRSIVSRLFTDARKLLLYSH-KDTSVKDMHKFLGNLHNYR 136

  Fly   101 --------------------------PLHSVIDVVNAFVTDER---------------------- 117
                                      |..:|.:::||.:..|:                      
 Frog   137 GTGLKLRDCLMDNEKFTDFLLKNISLPAVAVEEIMNAHLKPEQVLVSGFQIHLKDLCNSTRLAEY 201

  Fly   118 --LHKAVV---------------------ELAEKANFVSAITTLITSDRF----DIIRSNISEII 155
              :|..||                     |.....:.:..||...:|..|    ||..|.:..:.
 Frog   202 VTIHNEVVANLSQKIICALPEEKLNLLEQEFRSNVDLLKPITKEFSSKSFPFLKDITDSLLHSLA 266

  Fly   156 SLVPEI-------ERRMNYSFDIKHLFSNRET------FVKLGVLLCGHPFPNTDTIPLVNEILE 207
            .|..|:       |.|....|    |.|...|      :..:..::||||......|..:|...:
 Frog   267 DLAKEVMTMKSWAEMRQEVMF----LTSGNATASPSTLYQAVSRIVCGHPEGGGLKIKSLNWYED 327

  Fly   208 SE----------DFSQANDAEIDAMPTRRRRRYEDLPTDWRPTKYCKRLYRDVTSTNQGKLTWNT 262
            :.          |.|...|:::         .|::     ..|.||..|.:::.|:...::.|..
 Frog   328 NNYKALFGGGEGDNSTDEDSQV---------AYDN-----STTPYCNDLMQNLESSPLYRMIWRA 378

  Fly   263 IKPIIQGRILYTPANAMTESVVKFSNASFEELDRLKQL----------------SRAAATILTKL 311
            :||::.|:|||||:...|:.::...|.:|:||...:.|                |.....::..|
 Frog   379 LKPLLVGKILYTPSTPATQMLMSEVNKTFQELSVFRDLGAMWEEVRPQIKNFMESSQEMDLIRTL 443

  Fly   312 HTNATFQEAFDNLLK------------LAKSPL-VKSLVGDDFD----IGEIERVFEYIRTNQLI 359
            .||...:...|..|.            |||... |::..|..:.    :.|.:||          
 Frog   444 LTNKGSKTFLDQQLNSTGWTTENISRFLAKETADVETENGPFYSWREALNETDRV---------- 498

  Fly   360 YDILTTVADLMDCVSADRFEAVESVEELHKRAYELNQNKLFLAALNLEDVGLKQ------ASYRL 418
               :.|::..|:||:.|:.|.|.:.|.|..::.||...:.|.|.:...|:..::      ..|::
 Frog   499 ---VLTLSRFMECVNLDKLEPVATEEMLIDKSMELLNERKFWAGIVFMDMPEEETELPHHVKYKI 560

  Fly   419 HMDTDNTQPTFENRNRFWFPGPADSMVIDLKY-HRGFVQLKQMVDLGIIKSKREEAGFAPEEDGP 482
            .||.||.:.|.:.::.:|.|||......|::| ..||..|:.:|:..||:               
 Frog   561 RMDIDNVERTNKIKDGYWDPGPRADPFEDMRYIWGGFSYLQDVVEQAIIR--------------- 610

  Fly   483 ESGRSLSGLFSIKQVENDTPDEDDDDFDLSLEESGDEKAAPKVSASASDHEATTISPSSLDGVTT 547
                                                                             
 Frog   611 ----------------------------------------------------------------- 610

  Fly   548 EEVRVTTEQTVVSGDPDLLLLKNEDVLKRSKRQGLFDLLGGFGGSGDANKKNKFEVDNMQFYTKQ 612
                   .||.|                 .||.|:                          |.:|
 Frog   611 -------VQTGV-----------------EKRTGI--------------------------YVQQ 625

  Fly   613 FPYPAFLNDVFKRGLYLAQGVQVAYLLGLVVFVALSVRERIWMRESRNSMLMRSMGLKAHSELVA 677
            .|||.:::|:|.|  .:::.:.:...|..:..||:.::..::.:|:|....||.|||......::
 Frog   626 MPYPCYVDDIFLR--VMSRSMPLFMTLAWIYSVAVIIKGIVYEKEARLKETMRIMGLDNGILWLS 688

  Fly   678 WALMSFLELCVIFALISGVLYSGGILGYTNWFFMMFYCLSFGLCLISFCYMCTNFFNSANIGAVA 742
            |.:.|.:.|.:..||:..:|.:|.:|.|::...:..:...|.:..||.|::.:..|:.||:.|..
 Frog   689 WFISSLIPLLMSAALLVLILKTGNLLPYSDPSVVFVFLSVFAVVTISQCFLISTIFSRANLAAAC 753

  Fly   743 SALLFFISLCPFIIVLMFD----AKLSVFESFLVDLSF---TTAFA----KG----WGELIRMEL 792
            ..:::|....|:::.:.:.    ..|.:|.|||..::|   ...||    :|    |..|:...|
 Frog   754 GGIIYFTLYLPYVLCVAWQDYVGYTLKIFASFLSPVAFGFGCEVFALLEEQGVGVQWDNLLESPL 818

  Fly   793 QQEGLTVRHLIQVGPARSECAMALLMFLLDLLLYAVI------------GLAYQRY--------- 836
            ::.|..:             ..:..|.|.|.|||.::            |:....|         
 Frog   819 EENGYNI-------------TTSGFMMLFDTLLYGIMTWYIEAVFPGQYGIPRPWYFPFTKSYWC 870

  Fly   837 ----KKTDNYSFVKVSRSQLDGK-------LGASLVNVSKLY--GSKCAVSNLSLDFARNQVSCL 888
                |:.:....|:...|::..:       ||.|:.|:.|:|  |.|.||..|:|:|...|::..
 Frog   871 GEECKEYNQPHTVQKGSSEVCMEEEPSHLPLGVSIQNLVKIYRNGKKVAVDGLTLNFYEGQITSF 935

  Fly   889 LGRNGAGKSTLIKLLTGQIRQSSGKVLLAGE----------HQVGVCWQDNILIPTLTAREHLQL 943
            ||.|||||:|.:.:|||....::|...:..:          ..:|||.|.|:|...||..||:..
 Frog   936 LGHNGAGKTTTMSILTGLFPPTTGTAYIMKKDIRTELNSIRQNLGVCPQHNVLFDALTVEEHIWF 1000

  Fly   944 YAQIKIPPGGSGGV--EEIRSEVAQTLQSLNFGKHESYPSWQLSGGYRRRLCVAIAFIASPSVVI 1006
            ||::|       |:  |::::|:.|.:..:.....:.|.:.|||||.:|:|.||:||:....|||
 Frog  1001 YARLK-------GLSEEKVKAEMEQMVNDVGLPHKKKYKTSQLSGGMQRKLSVALAFVGGSKVVI 1058

  Fly  1007 LDEPCNGVDAKARKDIWQLIERLRQGRAVIFATHFMDEAKYLSDSLVIMRNGRIIAQHS------ 1065
            ||||..|||..:|:.||:|:.:.||||.:|.:||.||||..|.|.:.|:.:|::....|      
 Frog  1059 LDEPTAGVDPYSRRGIWELLIKYRQGRTIILSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKN 1123

  Fly  1066 ------------RD----------------------SLQRLCTSNYSIRLRCADATGVTFVI--- 1093
                        ||                      |.|..|..:.|..:....|:|.|..:   
 Frog  1124 QLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKESSKQTACKQHPSPMIAAPSASGTTAAVITK 1188

  Fly  1094 -------QKAQQLLPQTQVTHSGA-------------------------------------ADYP 1114
                   ||.:....:..|:.|.:                                     .|..
 Frog  1189 HSKHTAGQKKEAKDREDSVSQSSSDAGLGSDHESDTMTIGLTDVSAISNLINKHVPEARLVEDIG 1253

  Fly  1115 HSLTINASYAEHLTPGAVEFLELLQS--------QVTAGSISDVEL----------------TTS 1155
            |.||....| |....||  |:||...        .:::..|:|..|                |:.
 Frog  1254 HELTYVLPY-EAAKEGA--FVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSD 1315

  Fly  1156 SSLE------------------QEFEQLNRNGEDAGPRRPASD-RSGVVAGPAMITDEPPTACKQ 1201
            .:|.                  .|.:..:.|..|..|....:| .||:....:..........:|
 Frog  1316 GTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQLKSWNLMRQQ 1380

  Fly  1202 FRLLMGKRLRHLSRNYRLLLYVLLLPALFELCAM-------------------W-------FVSY 1240
            |..|:.|||.:..|:.:.....::|||:|.|.|:                   |       |.|.
 Frog  1381 FTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWMYDEQYTFFSN 1445

  Fly  1241 RLEDD---------------FDTVLPLSRSLYPQTAQFLSHERATSF---------------SEK 1275
            ...||               |.|......|:...:......|.:|.|               .|.
 Frog  1446 DAPDDQGTQALLKALIDKPGFGTACMEGHSVMKVSCSGEEEEWSTQFVSQSVMDLFLNGNWTMEN 1510

  Fly  1276 LYPQLRTSCDH-----------LGECRVFNTSQQSYDWVLNSWGE---------YS--------- 1311
            ..|....|.|.           .|....|...|.:.|.:.|..|.         ||         
 Frog  1511 PSPSCECSSDKRKKMLPICPPGAGGLPPFQRRQNTSDILQNLTGRNISDYLVKTYSQIIEKSLKN 1575

  Fly  1312 -----ERRYGGYGLNGS---------------------------GAT------------------ 1326
                 |.||||:.|..|                           ||.                  
 Frog  1576 KIWVNEFRYGGFSLGASNSPALPPNEEVVASINHIKKRLELPQNGAANRFLDSFGAFMKGLDTKD 1640

  Fly  1327 ---VWYNNKGYHSMMAWLNDLNSELLRTTMNDSES----SILTLNEPWKLGFAELSTSSILRQAG 1384
               ||:||||:|::.|:||.:|:.:||:.:.:.|.    .|...|.|..|...:||..:::..:.
 Frog  1641 NVKVWFNNKGWHAVGAFLNVMNNAILRSKLREGEDPASYGITAFNHPLNLTKEQLSEVALMTTSV 1705

  Fly  1385 DGSMVFILLIAFGLVVASGSVYLVNERVNGEKLQQRLCGVSAVTYWLVALVWDYLVMVLGLIVCL 1449
            |..:...::.|...|.||..|:|:.|||:..|..|.:.||..|.|||...|||....|:...:.:
 Frog  1706 DVLVSICVIFAMSFVPASFVVFLIQERVSKAKHMQCISGVKPVIYWLANFVWDMCNYVVPATLVI 1770

  Fly  1450 VVILMFGMPVFVDRQQLVGIIGLSLAFSFACVPSVHVAEKIFSDSSIAIVSIFCANLIVPLVTMG 1514
            ::.:.|....:|....|..:..|.|.:.::..|.::.|..||...|.|.|.:...||.:.:....
 Frog  1771 IIFICFQQDSYVSSSNLPVLALLLLLYGWSITPLMYPASFIFKIPSTAYVVLTSVNLFIGINGSV 1835

  Fly  1515 IILILGVVGDGPAWDDWRHALNQAFLIFPIHALGDGFLELCKNYMVALVFRRYDIDSYKHPLASD 1579
            ...:|.:..:... .:....|....||||...||.|.:::.||..:|....|:..:.:..|::.|
 Frog  1836 ATFVLELFTNNKL-SNINEILKSVLLIFPHFCLGRGLIDMVKNQAMADALERFGENRFVSPMSWD 1899

  Fly  1580 LLGRHFTALLLVGVAALIINVLIEWHLL---RRLWQRVERLLD-----CTYRRELDKLGQLKLVN 1636
            |:||:..|:.:.||....|.::|::...   |.:..::..::|     ...|:.:::.|:..::.
 Frog  1900 LVGRNLFAMAVEGVVFFAITLMIQYRFFIKPRPVNAKLPPVVDEDEDVARERQRINEGGRNDILE 1964

  Fly  1637 IQSIFKSCVDTGEAVRAENLWLAYR-RGHYAVRNVNFSVQRGECFGLLGKNGAGKSTIFKLLTGQ 1700
            ::.:.|                .|| :...||..:...:..||||||||.|||||:|.||:|||.
 Frog  1965 LKGLTK----------------IYRMKRKPAVDRLCVGIPPGECFGLLGVNGAGKTTTFKMLTGD 2013

  Fly  1701 LQPDVGQIYFEQPGI-----------SYCPQSNPLDPLLTTTECIRFYGRLRGI--RDLDQFLDR 1752
            .....|:.:.:...|           .||||.:.::.|||..|.:..|..|||:  :::.:..:.
 Frog  2014 TDVTAGEAFLKNHSILRNIHEVHQNMGYCPQFDAINELLTGREHLELYALLRGVPEKEVCKVAEW 2078

  Fly  1753 VLDTYELRPYKDVQVRNLSGGNRRKLTVAVTCCGCTPTVLMDEPTSDMDPVTRDMVYATIEQLLL 1817
            .:....|..|.:....|.||||:|||:.|:...|..|.|.:||||:.|||..|..::.....::.
 Frog  2079 AIRKLGLVKYSEKHAGNYSGGNKRKLSTAIALIGGPPVVFLDEPTTGMDPKARRFLWNCALSVIK 2143

  Fly  1818 ARRAVVLTSHSVSEIEHLCQRVAVLRAGQVIASDSPQRLKSEHG-GYYAVTCFCG------PAQQ 1875
            ..|:|||||||:.|.|.||.|:|::..|:.....|.|.||:..| ||..:....|      |.::
 Frog  2144 EGRSVVLTSHSMEECEALCTRMAIMVNGRFKCLGSVQHLKNRFGDGYTIIVRIAGSNPDLKPVEE 2208

  Fly  1876 AILSRSLNQRLPGARDLQHYAHSLRFLVRVRSPGSLGDAPLLSELFAILC--DVCVNVARFSLSR 1938
                 ..:...||:...:.:...|::  ::||..|     .|:.:|:||.  ...:::..:|:|:
 Frog  2209 -----FFSHAFPGSVLKEKHRSMLQY--QLRSSQS-----SLARIFSILSKNKKRLHIEDYSVSQ 2261

  Fly  1939 CRFETVFERIL-DSSESNGSN-GVHKDQ 1964
            ...:.||.... |.|:.:..: .:||:|
 Frog  2262 TTLDQVFVNFAKDQSDDDQKDLSLHKNQ 2289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34120NP_001285513.1 ABC2_membrane_3 <621..760 CDD:289468 32/139 (23%)
ABC_subfamily_A 859..1073 CDD:213230 87/268 (32%)
drrA 865..1162 CDD:130256 111/440 (25%)
ABC2_membrane_3 1230..1601 CDD:289468 113/513 (22%)
Mem_trans 1436..>1552 CDD:304621 26/116 (22%)
ABC_subfamily_A 1651..1857 CDD:213230 77/220 (35%)
drrA 1666..1945 CDD:130256 94/301 (31%)
abca1XP_004910916.1 rim_protein 1..2272 CDD:130324 544/2480 (22%)
ABC_subfamily_A 903..1122 CDD:213230 83/226 (37%)
ABC_subfamily_A 1963..2183 CDD:213230 78/236 (33%)
DUF4162 2177..2269 CDD:290451 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D131191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.