DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34120 and abca10

DIOPT Version :8

Sequence 1:NP_001285513.1 Gene:CG34120 / 318066 FlyBaseID:FBgn0083956 Length:1998 Species:Drosophila melanogaster
Sequence 2:XP_012822740.1 Gene:abca10 / 100485734 XenbaseID:XB-GENE-6464279 Length:1450 Species:Xenopus tropicalis

Alignment Length:1460 Identity:346/1461 (24%)
Similarity:580/1461 (40%) Gaps:364/1461 (25%)


  Fly   633 VQVAYLLGLVVFVALSVRERIWMRESRNSMLMRSMGLKAHSELVAWALMSFLELCVIF--ALISG 695
            |.:.|||...|     .|||..|:|:     :|.|.|:   :|..|.....|..|.:|  |.:..
 Frog   196 VSLMYLLSQYV-----TRERYEMKET-----LRLMRLQ---DLAFWLSWGLLYSCYVFIVANLMT 247

  Fly   696 VLYSGGILGYTNWFFMMFYCLSFGLCLISFCYMCTNFFNSANIGAVASALLFFISLCPFIIVLMF 760
            ::....:...:::..:||....:|:.|:||.:|.:..|.:....|:|.   |||:|....:.|:.
 Frog   248 LVTKPFVFITSSYGIIMFMFFLYGVALMSFTFMLSALFRNPRATAIAG---FFITLLLSALGLIL 309

  Fly   761 DAK---------LSVFESFLVDLSFTTAFAKGWGELIRMELQQEGLTVRHLIQVGPARSECAMAL 816
            .:|         ||:|..|        |||.|..:.:.||..|||:....|.........|.::|
 Frog   310 LSKHVPKSVEVLLSIFPQF--------AFAVGITQSVHMENDQEGVYFSDLTGGSSHMLSCFISL 366

  Fly   817 LM---FLLDLLLYAVIGLAYQRYKKTDNYSFVKVS-----------------------------R 849
            ::   |.:.|.||....||.:...|.:...|:|.|                             .
 Frog   367 VLDSVFYMGLTLYFEKVLADKHGVKHEPLFFLKASYWSKEKPSPLMAQTDDSGESSLGHFVEKVP 431

  Fly   850 SQLDGKLGASLVNVSKLYGSKC----AVSNLSLDFARNQVSCLLGRNGAGKSTLIKLLTGQIRQS 910
            :.|.||....:..|.|.|..|.    |:..|.|:....|::.|||.:||||:||:.:|:|....|
 Frog   432 ADLHGKEAIRIHGVKKTYYDKDKNTEALRGLDLNIYEGQITALLGHSGAGKTTLLNILSGMCPTS 496

  Fly   911 SGKVLLAG------------EHQVGVCWQDNILIPTLTAREHLQLYAQIKIPPGGSGGVEEIRSE 963
            .|...:..            :.:||.|.|.:|....||.:|:|.::|.||..|.     :|:..:
 Frog   497 GGSATVCNYKLSNMRHLEEIKKRVGFCPQGDIKFDPLTVKENLTVFAMIKGIPS-----KEVAHK 556

  Fly   964 VAQTLQSLNFGKHESYPSWQLSGGYRRRLCVAIAFIASPSVVILDEPCNGVDAKARKDIWQLIER 1028
            |...|..|.....|:..:.:||||.:|:|...||.:..|.|::||||..|:|..:|.:||.:::.
 Frog   557 VQTVLSDLQMNDIENIEASKLSGGQKRKLTFGIAILGDPQVLLLDEPTAGLDPCSRHNIWTILKE 621

  Fly  1029 LRQGRAVIFATHFMDEAKYLSDSLVIMRNGRIIAQHSRDSLQRLCTSNYSIRLRCADATGVTFVI 1093
            .:..|..:.:|.|||||..|:|..|::..|::....:...|:|.....|.:|::.:.:..|..:.
 Frog   622 SKADRVTLLSTQFMDEADILADRKVVISKGKLKCVGTSLFLKRKWGVGYHLRMQVSPSCDVELMT 686

  Fly  1094 QKAQQLLPQTQVTHSGAADYPHSLTINASYAEHLTPGAVEFLELLQSQVTAGSIS-DVELTTSSS 1157
            ...:|.:|.|::|.....:..::|..     |::......||. |..||....:: .|.:||   
 Frog   687 SIIKQHIPSTKLTTQNEEELTYTLPF-----ENMDVFPDLFLH-LDGQVGNSIVNYGVSMTT--- 742

  Fly  1158 LEQEFEQLNRNGEDAGPRRPASDRSGVVAGPAMITDEPPTACKQFRLLMGKRLRHLSRNYRLLLY 1222
            |:..|.:|...||             :.:|.:.|.|                             
 Frog   743 LDDVFLKLEGEGE-------------IESGGSSIED----------------------------- 765

  Fly  1223 VLLLPALFELCAMWFVSYRLEDDFDTVLPLSRSLYPQTAQFLSHERATSFSEKLYPQLRTSCDHL 1287
                          ||....|.:.                                         
 Frog   766 --------------FVGAVKEQNI----------------------------------------- 775

  Fly  1288 GECRVFNTSQQSYDWVLNSWGEYSER--RYGG-----YGLNGSGATVWYNNKGYHSMMAWLNDLN 1345
             |.:|.|             |||...  :|.|     ....|...|:..|.|.::|:...||.::
 Frog   776 -EVQVVN-------------GEYDMETVKYRGAIEVSQMEKGYNFTIVANPKAFNSLPVLLNIIS 826

  Fly  1346 SELLRTTMNDSESSILTLNEPWKLGFAELSTSSILRQAGDG---------SMVFILLI--AFGLV 1399
            :.||:         ||.::..:::....::|        ||         |::|.::.  ||...
 Frog   827 NALLK---------ILKVSGHFRVWNHPITT--------DGTDIIFLPYMSLIFFIIFASAFCPH 874

  Fly  1400 VASGSVYLVNERVNGEKLQQRLCGVSAVTYWL------VALVWDYLVMVLGLIVCL-VVILMFGM 1457
            :|..|.  .:.|:|... |.|:.|:....||.      |.|.|..|.:::.:.... ..||:..:
 Frog   875 IAMSST--EDNRINARN-QLRISGLFPSAYWFGQALVDVILYWILLFLMVAIYFAFNSYILLDFV 936

  Fly  1458 PVFVDRQQLVGIIGLSLAFSFACVPSVHVAEKIF------SDS---SIAIVSIFCANLIVPLVTM 1513
            |..|   .::||||    :..|.|..|:|...||      :||   ...|.|.|      |::.|
 Frog   937 PAMV---MIIGIIG----YGTAMVLYVYVISFIFGRGKSHTDSWSLFFVITSTF------PVMFM 988

  Fly  1514 GIILILGVVGDGPAWDDWRHALNQAFLIFPIHALGDGFLELCKNYMVALVFRRYDIDSYKHPLAS 1578
            .:.:.              ......:.:||..|| .|.:|                  |.:.|..
 Frog   989 DVFMF--------------RLFTIYYFVFPASAL-SGIME------------------YTYRLQV 1020

  Fly  1579 DLLGRHFTALL------LVGVAALIINVLIEWHL-LRRL----WQRVERLLDCTYRRELDKLGQ- 1631
            ...|..:|||:      |..:...::...:||.. ||.|    ..|:.| ...|.::..::||. 
 Frog  1021 FPGGSEYTALIEQCTPYLHIIIFFVLLWFLEWKFGLRSLTIDPLFRISR-RKITTKKNPEELGND 1084

  Fly  1632 ------------LKLVNIQSIFKSCVDTGEAVRAENLWLAYRRGHY-------AVRNVNFSVQRG 1677
                        .|...|.::.:..|...:::|.|  :...:.|.:       |.:||:|.|::|
 Frog  1085 VDEDVLAEKERVKKAATIANVEEKPVIIADSLRKE--YKVKKGGSFFKKNKRAATKNVSFCVKKG 1147

  Fly  1678 ECFGLLGKNGAGKSTIFKLLTGQLQPDVGQIYF---EQPG----ISYCPQSNPLDPLLTTTECIR 1735
            |..||||.|||||:|...:|.|:::|..|::..   :..|    :.||||.|||.|.||..|.:.
 Frog  1148 EVLGLLGPNGAGKTTSMYMLAGEVKPTAGEVLLCGNDPVGSTGFLGYCPQDNPLWPNLTVKEHLE 1212

  Fly  1736 FYGRLRGIR--DLDQFLDRVLDTYELRPYKDVQVRNLSGGNRRKLTVAVTCCGCTPTVLMDEPTS 1798
            .|..::|::  |....::||....||:.:.....|.||.|..||:..|::..|....||:|||::
 Frog  1213 IYAAVKGMKKEDASIAINRVASALELKEHMGKAARKLSLGVSRKVCFAISMLGNPNIVLLDEPST 1277

  Fly  1799 DMDPVTRDMVYATIEQLLLAR-RAVVLTSHSVSEIEHLCQRVAVLRAGQVIASDSPQRLKSEHGG 1862
            .:||..:..::..|......: |..:||:|.:.|.|.:|.|||::.:|::....|.|:|||:.|.
 Frog  1278 GLDPKGQQRLWRAIRAAFKNKDRGAILTTHYMEEAEAVCDRVAIMVSGKLRCIGSIQQLKSKFGK 1342

  Fly  1863 YYAVTCFCGPAQQAILSRSLNQRLPGARDLQHYAHSLRF--LVRVRSPGSLGDAPLLSELFAILC 1925
            .|.:......:.|  :.:..|:.:   |...|.|...||  |:..:.|  :.:...||:.|.:|.
 Frog  1343 GYLLEIKVKESHQ--VDQIHNEII---RIFPHAARQDRFSSLLVYKIP--MDNVQSLSQAFLLLE 1400

  Fly  1926 DV--CVNVARFSLSRCRFETVFERILDSSE 1953
            :.  ..|:..:|.|:...|.||..:....|
 Frog  1401 EAKRAYNIEEYSFSQSTLEQVFIELAKEQE 1430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34120NP_001285513.1 ABC2_membrane_3 <621..760 CDD:289468 34/129 (26%)
ABC_subfamily_A 859..1073 CDD:213230 71/230 (31%)
drrA 865..1162 CDD:130256 88/314 (28%)
ABC2_membrane_3 1230..1601 CDD:289468 76/411 (18%)
Mem_trans 1436..>1552 CDD:304621 28/126 (22%)
ABC_subfamily_A 1651..1857 CDD:213230 73/223 (33%)
drrA 1666..1945 CDD:130256 92/293 (31%)
abca10XP_012822740.1 ABC2_membrane_3 <193..336 CDD:289468 43/164 (26%)
CcmA 438..750 CDD:224054 90/326 (28%)
ABC_subfamily_A 440..663 CDD:213230 70/228 (31%)
ABC2_membrane_3 772..1049 CDD:289468 74/398 (19%)
Cytochrome_B 911..1050 CDD:278462 37/185 (20%)
CcmA 1109..1428 CDD:224054 97/328 (30%)
ABC_subfamily_A 1111..1337 CDD:213230 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96936551
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D131191at2759
OrthoFinder 1 1.000 FOG0000137
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.