DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34120 and abca1b

DIOPT Version :8

Sequence 1:NP_001285513.1 Gene:CG34120 / 318066 FlyBaseID:FBgn0083956 Length:1998 Species:Drosophila melanogaster
Sequence 2:XP_005173137.1 Gene:abca1b / 100136868 ZFINID:ZDB-GENE-030131-9826 Length:2282 Species:Danio rerio

Alignment Length:2479 Identity:550/2480 (22%)
Similarity:931/2480 (38%) Gaps:727/2480 (29%)


  Fly    13 LLRKDLLVRWRQKGLSLILLAWPVMVFMLLYLIRLKYGSEELEACQYPTRLLPTKNQVVPAAFSY 77
            ||.|:...|.||....|..:.||:.:|.:|..:||.|...|...|.:|.:.:|:.. .:|.....
Zfish    10 LLWKNFTYRRRQTLQLLTEIVWPLFIFFILIAVRLYYPPYEQHECHFPNKAMPSAG-TLPWIQGI 73

  Fly    78 ICSIENRCQPAHP-----------YEE------YSHWKEAPLHS-----------VIDVV----- 109
            :|:..|.|. .||           :.:      :|..|:..|:|           :||.|     
Zfish    74 VCNANNPCF-RHPTPGESPGVVGNFNDSIISRLFSDAKKILLYSQNDKSLDGFKELIDAVKVMQN 137

  Fly   110 -----------------------NA-----FVT-----DERLHKAVV------------------ 123
                                   ||     :||     |..|.|.::                  
Zfish   138 NTAGFKLKDFLHEDETLSTFLLQNASFTENYVTNILDADVNLEKVLIKGFGVHLRDMCSSIKLED 202

  Fly   124 -------------------------ELAE---KAN--FVSAITTLITSDRFDIIR-----SNISE 153
                                     :.||   |:|  |:..:.:.|.::..|:.:     .|:.|
Zfish   203 FVTIPDTSVARFTQDMICRSPKNWLDQAESHFKSNLDFLKPVRSEIRTNATDVRKVTKATDNLLE 267

  Fly   154 II-SLVPEIERRMNYSFDIKH--LFSNRET-------FVKLGVLLCGHPFPNTDTIPLVNEILES 208
            .: ||..|:....::| |:::  ||.....       :..:..::||||......|..:|...:|
Zfish   268 SLGSLAVELASMRSWS-DLRNEILFLTENATGSPSLMYQAVSRIVCGHPEGGGLKIKSLNWYEDS 331

  Fly   209 ED---FSQANDAEIDAMPTRRRRRYEDLPTDWRPTKYCKRLYRDVTSTNQGKLTWNTIKPIIQGR 270
            ..   |...||::...:|.     |::     ..|.||..:.|::.::...::.|..:||::.|:
Zfish   332 NFQALFGNHNDSDDQPVPV-----YDN-----TTTPYCNSMMRNMEASPISRMIWRALKPLLMGK 386

  Fly   271 ILYTPANAMTESVVKFSNASFEELDRLKQLSRAAATILTKLHTNATFQEAFDNLLKLAKSPLVKS 335
            |||||.:..|:.::...|.:|:||..|:.|.........|:.   .|.|. .|.:.|.::.|:.:
Zfish   387 ILYTPHSPATQKIIHEVNKTFQELGILRDLGGMWEEARPKVW---NFMEN-SNEMDLMRTLLLNN 447

  Fly   336 LVGDDFDI------GEIERVFEYI---------------------RTNQLIYDILTTVADLMDCV 373
            |..:.|..      ..:|.|..::                     .|:|.|    .:::..|:||
Zfish   448 LTANFFSAQLAGTQWSVEDVISFLSKHSEDTRPQGTAFTWRDVFNETDQAI----MSISRFMECV 508

  Fly   374 SADRFEAVESVEELHKRAYELNQNKLFLAALNLEDVGLKQA------SYRLHMDTDNTQPTFENR 432
            :.|:.|.|.:.|:|...:..|..|:.|.|.:...|:....:      :|::.||.||.:.|.:.:
Zfish   509 NLDKLEPVSTEEKLVNESMSLLDNRKFWAGIVFLDIPSNSSELPPNVNYKIRMDIDNVERTNKIK 573

  Fly   433 NRFWFPGPADSMVIDLKY-HRGFVQLKQMVDLGIIKSKREEAGFAPEEDGPESGRSLSGLFSIKQ 496
            :.:|.|||......||:| ..||..|:.:|:..||                   |:::|      
Zfish   574 DGYWDPGPRADPFEDLRYIWGGFSYLQDVVEHSII-------------------RAVTG------ 613

  Fly   497 VENDTPDEDDDDFDLSLEESGDEKAAPKVSASASDHEATTISPSSLDGVTTEEVRVTTEQTVVSG 561
                           |.|::|                                            
Zfish   614 ---------------SKEKTG-------------------------------------------- 619

  Fly   562 DPDLLLLKNEDVLKRSKRQGLFDLLGGFGGSGDANKKNKFEVDNMQFYTKQFPYPAFLNDVFKRG 626
                                                          .|.:|.|||.:::|:|.| 
Zfish   620 ----------------------------------------------VYIQQMPYPCYVDDIFLR- 637

  Fly   627 LYLAQGVQVAYLLGLVVFVALSVRERIWMRESRNSMLMRSMGLKAHSELVAWALMSFLELCVIFA 691
             .:::.:.:...|..:..||:.::..::.:|:|....||.|||.......:|.:.|.:.|.:...
Zfish   638 -IMSRSMPLFMTLAWMYSVAIIIKGVVYEKEARLKETMRIMGLDNGILWFSWFISSLIPLLISAG 701

  Fly   692 LISGVLYSGGILGYTNWFFMMFYCLSFGLCLISFCYMCTNFFNSANIGAVASALLFFISLCPFII 756
            |:..:|..|.:|.|::...:..:..||.:..|..|::.:..|..||:.|....:::|....|:::
Zfish   702 LLVLLLKMGNLLPYSDPGVVFLFLGSFAVVTIMQCFLISTAFARANLAAACGGIIYFTLYLPYVL 766

  Fly   757 VLMFDAKLSVFESFLVDLSFTTAFAKGWGELIRMELQQEGLTVRHLIQVGPARSE---CAMALLM 818
            .:.:...:......:..|....||..|.......|.|..|:...:|.. .|...:   ....|::
Zfish   767 CVAWQDYVGFAAKVIASLLSPVAFGFGCEYFALFEEQGVGIQWNNLFS-SPVEEDDYNLTTCLIL 830

  Fly   819 FLLDLLLYAVI------------GLAYQRY--------------------KKTDNYSFVKVSRSQ 851
            ...|..||.|:            |:....|                    .|..|...|.:....
Zfish   831 MYFDAFLYGVMTWYIETVFPGQYGIPRPWYFPFTKSYWFGENSTNNTAIHGKKSNAGAVCIEEEP 895

  Fly   852 LDGKLGASLVNVSKLY--GSKCAVSNLSLDFARNQVSCLLGRNGAGKSTLIKLLTGQIRQSSGKV 914
            ...|||..:.|:.|:|  |.|.||..|:|.|...|::..||.|||||:|.:.:|||....:||..
Zfish   896 THLKLGVYIENLVKVYRHGKKLAVDGLTLGFHEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTA 960

  Fly   915 LLAGE----------HQVGVCWQDNILIPTLTAREHLQLYAQIKIPPGGSGGV--EEIRSEVAQT 967
            .:.|:          ..:|||.|.|:|...||..||:..||::|       |:  ||:::|:.|.
Zfish   961 YIMGKDIRSELSSIRQSLGVCPQHNVLFSMLTVEEHIWFYARLK-------GLSEEEVKAEMEQI 1018

  Fly   968 LQSLNFGKHESYPSWQLSGGYRRRLCVAIAFIASPSVVILDEPCNGVDAKARKDIWQLIERLRQG 1032
            |............:.|||||.:|:|.||:||:....|||||||..|||..||:.||.|:.:.|.|
Zfish  1019 LSDTGLPHKRKSRTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYARRGIWDLLLKYRAG 1083

  Fly  1033 RAVIFATHFMDEAKYLSDSLVIMRNGR---------------------IIAQHSRDSLQRLCTSN 1076
            |.::.:||.||||..|.|.:.|:.:|:                     ::.:::..||.....|:
Zfish  1084 RTILLSTHHMDEADILGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSS 1148

  Fly  1077 YSIRL----------------------RCADATGVTF----VIQKAQQLLPQTQVTHSGAA---- 1111
            .::..                      ..|.|.|.::    |:.....::.:..:.|..||    
Zfish  1149 STVSFVKKDDNASESSSDAGLGSDQESEAATAIGTSWPESPVVPVDVTIISRLILKHVPAARMVE 1213

  Fly  1112 DYPHSLTINASYAEHLTPGAVEFLELLQSQVTAGSISDVELTTSSSLEQEFEQLNRNGEDAG--- 1173
            |..|.:|....|........||....|..::....||...: :.::||:.|.::   .||:|   
Zfish  1214 DQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGV-SDTTLEEIFLKV---AEDSGVDT 1274

  Fly  1174 ------------PRRPA--SDRSGVVAGPAMITDEPPTAC------------------------- 1199
                        .||.|  :|....:   ..:|::....|                         
Zfish  1275 EMLSDGTLPVRRQRRHAFGADHQSCL---KPLTEDDSFDCNESEGDPESKETDYLSGSDGKGSYQ 1336

  Fly  1200 --------KQFRLLMGKRLRHLSRNYRLLLYVLLLPALFELCAM-------------------W- 1236
                    :||..|:.|||.:..|:.:.....::|||:|...|:                   | 
Zfish  1337 VKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALNPWM 1401

  Fly  1237 ----FVSYRLEDDFD-TVLPLSRSLY------------------PQT---AQFLSHERATSFSEK 1275
                |:.:..:..:| :...|.|:|:                  |.|   .::.:.|...|..|.
Zfish  1402 YEEQFMFFSEDAPYDVSTHKLLRALFDDPGFGTRCMKGESIPDAPCTMGDEEWSTPEVPESIIEI 1466

  Fly  1276 L----------YPQLRTSCD----HLGEC------------------------------------ 1290
            |          .|....||:    .|.||                                    
Zfish  1467 LTTRNWTMNDPSPACECSCNGKKKMLPECPAGAGGLPPPQIKISETETLQNLTGRNISDYLVKTY 1531

  Fly  1291 -RVFNTSQQSYDWVLNSWGEYSERRYGGYGL------------------------------NGSG 1324
             ::...|.::..||       :|.||||:.|                              :||.
Zfish  1532 AQIIGKSLKNKIWV-------NEFRYGGFSLGARSTQVLPPAEEIDDAISRVREIFQLGKDSGSA 1589

  Fly  1325 A--------------------TVWYNNKGYHSMMAWLNDLNSELLRTTM----NDSESSILTLNE 1365
            |                    .:|:||||:||:.|:||.:|:.:||..:    :.||..|...|.
Zfish  1590 ADRFLKSLSAFINGLDTKNNVKIWFNNKGWHSIGAFLNVMNNGILRANLPPGKDPSEFGITAYNH 1654

  Fly  1366 PWKLGFAELSTSSILRQAGDGSMVFILLIAFGLVVASGSVYLVNERVNGEKLQQRLCGVSAVTYW 1430
            |..|...:||..:::..:.|..:...::.|...|.||..|:|:.||||..|..|.:.||....||
Zfish  1655 PLNLTKEQLSQVALMTTSVDVLVSICVIFAMSFVPASFVVFLIQERVNKAKHMQFISGVQPYLYW 1719

  Fly  1431 LVALVWDYLVMVLGLIVCLVVILMFGMPVFVDRQQLVGIIGLSLAFSFACVPSVHVAEKIFSDSS 1495
            |...:||....|:...:.:::.:.|....:|....|..:..|.|.:.::..|.::.|..:|...|
Zfish  1720 LANFLWDMCNYVVPATLVILIFVCFQQKAYVSATNLPVLALLLLLYGWSITPLMYPASFLFKIPS 1784

  Fly  1496 IAIVSIFCANLIVPL---VTMGIILILGVVGDGPAWDDWRHALNQAFLIFPIHALGDGFLELCKN 1557
            .|.|.:...|:::.:   ::..::.:.|....|...|    .|....||||...||.|.:::.||
Zfish  1785 TAYVVLTSVNILIGINGSISTFVMELFGNHEIGGIND----ILKNVLLIFPHFCLGRGLIDMVKN 1845

  Fly  1558 YMVALVFRRYDIDSYKHPLASDLLGRHFTALLLVGVAALIINVLIEWH-------LLRRLWQRVE 1615
            ..:|....|:..:.::.||..|::|::..|:.:.||...||.|||::.       |..:|....|
Zfish  1846 QAMADALERFGENRFRSPLEWDMVGKNLFAMAVEGVVFFIITVLIQYRFFFEPKSLCPKLSPIGE 1910

  Fly  1616 RLLDCTYRRE--LDKLGQ---LKLVNIQSIFKSCVDTGEAVRAENLWLAYRRGHYAVRNVNFSVQ 1675
            ...|....|:  :...||   |:|..:..::|                  |:...||..:...:.
Zfish  1911 EDEDVARERQRIMSGAGQGDILELRQLTKVYK------------------RKQKPAVDRLCVGIP 1957

  Fly  1676 RGECFGLLGKNGAGKSTIFKLLTGQLQPDVGQIYFEQPGI-----------SYCPQSNPLDPLLT 1729
            .||||||||.|||||::.||:|||......|:.:.....|           .||||.:.::.|||
Zfish  1958 PGECFGLLGVNGAGKTSTFKMLTGDSVVTKGEAFIAGKSILREIDEVHQNMGYCPQFDAINDLLT 2022

  Fly  1730 TTECIRFYGRLRGIRDLDQFLDRVLDTYE-------LRPYKDVQVRNLSGGNRRKLTVAVTCCGC 1787
            ..|.:.||..|||:.:     :.|....|       |..|.|....:.||||.|||:.|::..|.
Zfish  2023 GREHLEFYAILRGVPE-----NEVCAVAEWGIRKLGLVKYVDKNAGSYSGGNMRKLSTAISLIGA 2082

  Fly  1788 TPTVLMDEPTSDMDPVTRDMVYATIEQLLLARRAVVLTSHSVSEIEHLCQRVAVLRAGQVIASDS 1852
            .|.|.:||||:.|||..|..::..|..::...|:|||||||:.|.|.||.|:|::..|:.....|
Zfish  2083 PPVVFLDEPTTGMDPKARRALWNCIHSVIKEGRSVVLTSHSMEECEALCTRMAIMVNGRFRCLGS 2147

  Fly  1853 PQRLKSEHG-GYYAVTCFCGPAQ--QAILSRSLNQRLPGARDLQHYAHSLRFLVRVRSPGSLGDA 1914
            .|.||:..| ||..:....||..  |.:: :.:...|||:...:.:.:.|::    :.|.||.. 
Zfish  2148 VQHLKNRFGDGYTIILRVAGPDPDLQPVM-KFIESELPGSTLKEKHRNMLQY----QLPSSLTS- 2206

  Fly  1915 PLLSELFAILC--DVCVNVARFSLSRCRFETVFERILDSSESNGSNGVHKDQQQQVAKNDLPSKS 1977
              |:.:|:||.  ...:.:..:|:|:...:.||....            |||....:.:.:..|.
Zfish  2207 --LAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFA------------KDQSDDHSDSSISRKG 2257

  Fly  1978 PAVGGTLET 1986
            .||...|.|
Zfish  2258 TAVNMALLT 2266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34120NP_001285513.1 ABC2_membrane_3 <621..760 CDD:289468 31/139 (22%)
ABC_subfamily_A 859..1073 CDD:213230 85/249 (34%)
drrA 865..1162 CDD:130256 103/362 (28%)
ABC2_membrane_3 1230..1601 CDD:289468 111/525 (21%)
Mem_trans 1436..>1552 CDD:304621 26/119 (22%)
ABC_subfamily_A 1651..1857 CDD:213230 79/224 (35%)
drrA 1666..1945 CDD:130256 99/302 (33%)
abca1bXP_005173137.1 rim_protein 1..2242 CDD:130324 542/2454 (22%)
ABC_subfamily_A 902..1121 CDD:213230 83/226 (37%)
ABC_subfamily_A 1932..2152 CDD:213230 82/243 (34%)
DUF4162 2146..2238 CDD:290451 25/100 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1131
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D131191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126568
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.