DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stg1 and Cacng7

Sequence 1:NP_001027082.1 Gene:stg1 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_573452.3 Gene:Cacng7 MGIID:1932374 Length:275 Species:Mus musculus

Alignment Length:219 Identity:67/220 (30%)
Similarity:103/220 (47%) Gaps:36/220 (16%)


  Fly   225 LWLITPVAASISVAIVIAALAGPQWLFTEE--KLPNANYNGTANFK-ALDDGAYITKYTKSSLWI 286
            |.|::.|..:..:.:|..|::...||:.||  .||.   |.|...| ||..|          ||.
Mouse     9 LTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQ---NQTTEVKMALHAG----------LWR 60

  Fly   287 LCTTLPGLDADSYNCVKIDYFSNEGYQPDPH---DSTAAIPYTVTKSCPIFLAAGVFLVISFIVF 348
            :|..   ...:...||..:||    .:|:.:   ::|..|..||..:.| |....:|||  |..|
Mouse    61 VCFF---AGREKGRCVASEYF----LEPEINLVTENTENILKTVRTATP-FPMVSLFLV--FTAF 115

  Fly   349 LIPTCSH---QNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIKVSYG 410
            :|....|   |..:..|.:||.||:|||.:::||:.|||.:..|:.:  ||.|:.|  .....||
Mouse   116 VISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMN--RPSSSEQ--YFHYRYG 176

  Fly   411 QSFFLFVFGFIVTEFVGVLNIFLF 434
            .||......|::.|..||::::||
Mouse   177 WSFAFAASSFLLKEGAGVMSVYLF 200

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 62/203 (31%)
Cacng7NP_573452.3 PMP22_Claudin 18..195 CDD:354884 62/204 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C72104914
eggNOG 1 0.900 E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_137723
Panther 1 1.100 O PTHR12107
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.790

Return to query results.
Submit another query.