DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and Cacng7

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_036009491.1 Gene:Cacng7 / 81904 MGIID:1932374 Length:304 Species:Mus musculus


Alignment Length:242 Identity:73/242 - (30%)
Similarity:112/242 - (46%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 SGGAGATDPQGGISNMTTVNGGYLWLITPVAASISVAIVIAALAGPQWLFTEE--KLPNANYNGT 264
            ||.||.|.....: .|:..:...|.|::.|..:..:.:|..|::...||:.||  .||.   |.|
Mouse    16 SGSAGPTGRPPPL-RMSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQ---NQT 76

  Fly   265 ANFK-ALDDGAYITKYTKSSLWILCTTLPGLDADSYNCVKIDYFSNEGYQPDPH---DSTAAIPY 325
            ...| ||..|          ||.:|..   ...:...||..:||    .:|:.:   ::|..|..
Mouse    77 TEVKMALHAG----------LWRVCFF---AGREKGRCVASEYF----LEPEINLVTENTENILK 124

  Fly   326 TVTKSCPIFLAAGVFLVISFIVFLIPTCSH---QNNLYYFSAGILFIVSGLVMLIGLIAYISILK 387
            ||..:.| |....:|||  |..|:|....|   |..:..|.:||.||:|||.:::||:.|||.:.
Mouse   125 TVRTATP-FPMVSLFLV--FTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSIN 186

  Fly   388 AEIGSKLRPRSTLQPALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLF 434
            .|:.:  ||.|:.|  .....||.||......|::.|..||::::||
Mouse   187 DEVMN--RPSSSEQ--YFHYRYGWSFAFAASSFLLKEGAGVMSVYLF 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 61/202 (30%)
Cacng7XP_036009491.1 PMP22_Claudin 45..224 CDD:419754 61/205 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834613
Domainoid 1 1.000 59 1.000 Domainoid score I10601
eggNOG 1 0.900 - - E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - otm43441
orthoMCL 1 0.900 - - OOG6_111421
Panther 1 1.100 - - LDO PTHR12107
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5605
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.