DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stg1 and cacng5a

Sequence 1:NP_001027082.1 Gene:stg1 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001313491.1 Gene:cacng5a ZFINID:ZDB-GENE-120104-4 Length:289 Species:Danio rerio

Alignment Length:224 Identity:64/225 (28%)
Similarity:101/225 (45%) Gaps:30/225 (13%)


  Fly   225 LWLITPVAASISVAIVIAALAGPQWLFTEEK--LPNANYNGTANFKALDDGAYITKYTKSSLWIL 287
            |.|::.|.|..|:.::..|::...||:.||.  ||            |:....|.....|.||.:
Zfish     9 LTLLSSVFAVCSLGLLGIAVSTDYWLYLEEGVILP------------LNQSTEIRMSLHSGLWRV 61

  Fly   288 C---------TTLP-GLDADSY-NCVKIDYFSNEGYQPDPHDSTAAIPYTVTKSCPIFLAAGVFL 341
            |         |.|| |...|.. .|..|:|......|. ..:|||::...:..:.|..|.:..|:
Zfish    62 CFLSESPASGTVLPTGKSGDEKGRCFTIEYVMPMNVQM-TSESTASVLKMIRSATPFPLVSLFFM 125

  Fly   342 VISFIVFLIPTCSHQNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIK 406
            .|.|::..|.....|..:..|.:||.||:|||.:::||:.|||    .|..::..|:....|...
Zfish   126 FIGFVLSNIGHIRPQRTILAFISGIFFILSGLSLVVGLVLYIS----SINDEMLNRTKTNEAYFS 186

  Fly   407 VSYGQSFFLFVFGFIVTEFVGVLNIFLFI 435
            ..||.||......|::||..||::::||:
Zfish   187 YKYGWSFAFAAVSFLLTEAAGVMSVYLFM 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 58/207 (28%)
cacng5aNP_001313491.1 PMP22_Claudin 8..209 CDD:304458 62/217 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C72122158
eggNOG 1 0.900 E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12107
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.