DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stg1 and cacng7

Sequence 1:NP_001027082.1 Gene:stg1 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001072749.1 Gene:cacng7 XenbaseID:XB-GENE-966233 Length:275 Species:Xenopus tropicalis

Alignment Length:227 Identity:68/228 (30%)
Similarity:105/228 (46%) Gaps:36/228 (16%)


  Fly   217 MTTVNGGYLWLITPVAASISVAIVIAALAGPQWLFTEE--KLPNANYNGTANFK-ALDDGAYITK 278
            |:..:...|.|::.|..:..:.:|..|::...||..||  .||.   |.|...| ||..|     
 Frog     1 MSNCSSRALTLLSSVFGACGLLLVGIAVSTDYWLHMEEGIVLPQ---NQTTEVKMALHAG----- 57

  Fly   279 YTKSSLWILCTTLPGLDADSYNCVKIDYFSNEGYQPDPH---DSTAAIPYTVTKSCPIFLAAGVF 340
                 ||.:|..   ...:...||..::|    :.||..   ::||.|..|:..:.| |....:|
 Frog    58 -----LWRVCFV---AGREKGRCVASEFF----HGPDTDIVTENTANILKTIRSATP-FPMVSLF 109

  Fly   341 LVISFIVFLIPTCSH---QNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQP 402
            ||  |..|:|....|   |..:..|.:||.||:|||.:::||:.|||.:..|:.:  ||.|:.| 
 Frog   110 LV--FTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLIVGLVLYISSINDEVMN--RPSSSEQ- 169

  Fly   403 ALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLF 434
             .....||.||......|::.|..||::::||
 Frog   170 -YFHYRYGWSFAFAASSFLLKEGAGVMSVYLF 200

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 62/203 (31%)
cacng7NP_001072749.1 PMP22_Claudin 18..195 CDD:328820 62/204 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C72106063
eggNOG 1 0.900 E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000191
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.790

Return to query results.
Submit another query.