DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and cacng7

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001072749.1 Gene:cacng7 / 780206 XenbaseID:XB-GENE-966233 Length:275 Species:Xenopus tropicalis


Alignment Length:227 Identity:68/227 - (29%)
Similarity:105/227 - (46%) Gaps:36/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 MTTVNGGYLWLITPVAASISVAIVIAALAGPQWLFTEE--KLPNANYNGTANFK-ALDDGAYITK 278
            |:..:...|.|::.|..:..:.:|..|::...||..||  .||.   |.|...| ||..|     
 Frog     1 MSNCSSRALTLLSSVFGACGLLLVGIAVSTDYWLHMEEGIVLPQ---NQTTEVKMALHAG----- 57

  Fly   279 YTKSSLWILCTTLPGLDADSYNCVKIDYFSNEGYQPDPH---DSTAAIPYTVTKSCPIFLAAGVF 340
                 ||.:|..   ...:...||..::|    :.||..   ::||.|..|:..:.| |....:|
 Frog    58 -----LWRVCFV---AGREKGRCVASEFF----HGPDTDIVTENTANILKTIRSATP-FPMVSLF 109

  Fly   341 LVISFIVFLIPTCSH---QNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQP 402
            ||  |..|:|....|   |..:..|.:||.||:|||.:::||:.|||.:..|:.:  ||.|:.| 
 Frog   110 LV--FTAFVISNIGHIRPQRTILAFVSGIFFILSGLSLIVGLVLYISSINDEVMN--RPSSSEQ- 169

  Fly   403 ALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLF 434
             .....||.||......|::.|..||::::||
 Frog   170 -YFHYRYGWSFAFAASSFLLKEGAGVMSVYLF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 61/202 (30%)
cacng7NP_001072749.1 PMP22_Claudin 18..195 CDD:389833 61/203 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10462
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - otm48588
Panther 1 1.100 - - LDO PTHR12107
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5605
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.