DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stg1 and cacng8

Sequence 1:NP_001027082.1 Gene:stg1 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001072217.2 Gene:cacng8 XenbaseID:XB-GENE-986071 Length:353 Species:Xenopus tropicalis

Alignment Length:238 Identity:63/239 (26%)
Similarity:99/239 (41%) Gaps:52/239 (22%)


  Fly   222 GGYLW-------LITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKA--------LD 271
            |..:|       |:|.|.|..:..::..|:....||:....:.|     |.|..:        .|
 Frog    10 GRMVWCEKGVQILLTTVGAFAAFGLMTIAIGTDYWLYARAFICN-----TTNISSEETPQKDKKD 69

  Fly   272 DGAYITKYTKSSLWILCTTLPGLDADSYN-CVKIDYFSNE-GYQPDPHDSTAAIPYTVTKSCPIF 334
            .|.    .|.|.||.:|.    |:..... ||||::|..: .|.   |||...:...|.      
 Frog    70 PGG----LTHSGLWRICC----LEGQKRGICVKINHFPEDTDYD---HDSAEYLLRVVR------ 117

  Fly   335 LAAGVFLVISFIVFLI-PTCSHQNNLY------YFSAGILFIVSGLVMLIGLIAYISILKAEIGS 392
             |:.:|.::|.::.|: ..|...:.:|      ...|||||:.:||..:||:|.|||....:.|:
 Frog   118 -ASSIFPILSAMLLLLGGLCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVYISANAGDPGT 181

  Fly   393 KLRPRSTLQPALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLFI 435
            |........     .|||.||:.....||:.|.:|||.:.::|
 Frog   182 KRDDEKKSH-----YSYGWSFYFGGLSFIIAEMIGVLAVNIYI 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 55/211 (26%)
cacng8NP_001072217.2 PMP22_Claudin 17..214 CDD:304458 60/225 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000191
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.