DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stg1 and cacng3a

Sequence 1:NP_001027082.1 Gene:stg1 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_021331621.1 Gene:cacng3a ZFINID:ZDB-GENE-090312-124 Length:407 Species:Danio rerio

Alignment Length:238 Identity:63/239 (26%)
Similarity:98/239 (41%) Gaps:42/239 (18%)


  Fly   215 SNMTTVNGGYLWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITK- 278
            :.|...|.|...|:|...|..:.:::..|:....||::         .|....|:::|.....| 
Zfish     6 ARMRVCNRGVQMLLTTAGAFAAFSLMTIAVGTDYWLYS---------RGVCRTKSVNDNDTNRKN 61

  Fly   279 ---YTKSSLWILCTTLPGLDADSYNCVKIDYFSNEG-YQPDPHDSTAAIPYTVTKSCPIFLAAGV 339
               .|.|.||..| .:.|:....  |..||:|..:. |:.|      |..|.:.    ...|:.:
Zfish    62 EEVLTHSGLWRQC-CMEGIFKGV--CKNIDHFPEDADYEQD------AAEYLLR----AVRASSL 113

  Fly   340 FLVISF-IVFLIPTCSHQNNLY------YFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPR 397
            |.::|. ::|:...|...:..|      ..||||.|:.:||..:||:|.|||....:.......|
Zfish   114 FPIMSVGLLFIGGVCVAASEFYKSRHNVILSAGIFFVSAGLSNIIGIIVYISSSAGDPNQSESKR 178

  Fly   398 STLQPALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLFINLQEV 440
            |..        ||.||:.....||:.|.||||.:.|||:...|
Zfish   179 SHW--------YGWSFYCGALSFIIAETVGVLTVHLFIDTHRV 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 52/206 (25%)
cacng3aXP_021331621.1 PMP22_Claudin 13..202 CDD:328820 56/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.