DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stg1 and TMEM235

Sequence 1:NP_001027082.1 Gene:stg1 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_011522922.1 Gene:TMEM235 HGNCID:27563 Length:334 Species:Homo sapiens

Alignment Length:229 Identity:46/230 (20%)
Similarity:84/230 (37%) Gaps:67/230 (29%)


  Fly   223 GYLWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITKYTKSSLWIL 287
            |.|.|...:.|.:|.|::.||:|...|...|  :.:|. ||:|     ..|......:.|.||.:
Human     5 GALLLAAALGALLSFALLAAAVASDYWYILE--VADAG-NGSA-----WPGRAELLSSHSGLWRI 61

  Fly   288 CTTLPGLDADSYNCVK-IDYFSNEGYQPDPHDSTAAIPY------TVTKSCPIFLAAGVFLVISF 345
            |....|       |:. :|.|::|..     |.:.::.:      .|....|:.|   |.||..:
Human    62 CEGQNG-------CIPLVDPFASESL-----DVSTSVQHLILLHRAVIVVLPLSL---VLLVCGW 111

  Fly   346 IVFLIPTCSHQNNLYYFSAGILFIVSGLVMLIGLIAYISIL------------------------ 386
            |..|:.:.:...:|..|        :|...|:|.:....:|                        
Human   112 ICGLLSSLAQSVSLLLF--------TGCYFLLGTLTTCRVLAKCSSEGSSEGPPVPAAGHMRTTV 168

  Fly   387 --KAEIGSKLRPRS---TLQPALIKVSYGQSFFL 415
              ::.:.:::|...   ||:|..:....|.|.::
Human   169 KSRSPLDNEIRKNPNDLTLRPICVLTLAGVSIYI 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 42/218 (19%)
TMEM235XP_011522922.1 PMP22_Claudin 28..251 CDD:304458 37/207 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.