DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stg1 and CACNG5

Sequence 1:NP_001027082.1 Gene:stg1 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_665810.1 Gene:CACNG5 HGNCID:1409 Length:275 Species:Homo sapiens

Alignment Length:211 Identity:56/212 (26%)
Similarity:95/212 (45%) Gaps:18/212 (8%)


  Fly   225 LWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITKYTKSSLWILCT 289
            |.|::.|.|...:.::..|::...||:.||.:.......|....:|..|          ||.:| 
Human     9 LTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSG----------LWRVC- 62

  Fly   290 TLPGLDADSYNCVKIDYFSNEGYQPDPHDSTAAIPYTVTKSCPIFLAAGVFLVISFIVFLIPTCS 354
            .|.|  .:...|..|:|......|. ..:||..:...:..:.|..|.:..|:.|.||:..|....
Human    63 FLAG--EERGRCFTIEYVMPMNTQL-TSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNIGHIR 124

  Fly   355 HQNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIKVSYGQSFFLFVFG 419
            ....:..|.:||.||:|||.:::||:.|||.:..|:.::.:...|    .....||.||......
Human   125 PHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAET----YFNYKYGWSFAFAAIS 185

  Fly   420 FIVTEFVGVLNIFLFI 435
            |::||..||::::||:
Human   186 FLLTESAGVMSVYLFM 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 50/194 (26%)
CACNG5NP_665810.1 PMP22_Claudin 9..195 CDD:328820 54/204 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C72119213
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12107
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.