DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and CACNG5

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_665810.1 Gene:CACNG5 / 27091 HGNCID:1409 Length:275 Species:Homo sapiens


Alignment Length:211 Identity:56/211 - (26%)
Similarity:95/211 - (45%) Gaps:18/211 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITKYTKSSLWILCT 289
            |.|::.|.|...:.::..|::...||:.||.:.......|....:|..|          ||.:| 
Human     9 LTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSG----------LWRVC- 62

  Fly   290 TLPGLDADSYNCVKIDYFSNEGYQPDPHDSTAAIPYTVTKSCPIFLAAGVFLVISFIVFLIPTCS 354
            .|.|  .:...|..|:|......|. ..:||..:...:..:.|..|.:..|:.|.||:..|....
Human    63 FLAG--EERGRCFTIEYVMPMNTQL-TSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNIGHIR 124

  Fly   355 HQNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIKVSYGQSFFLFVFG 419
            ....:..|.:||.||:|||.:::||:.|||.:..|:.::.:...|    .....||.||......
Human   125 PHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAET----YFNYKYGWSFAFAAIS 185

  Fly   420 FIVTEFVGVLNIFLFI 435
            |::||..||::::||:
Human   186 FLLTESAGVMSVYLFM 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 49/193 (25%)
CACNG5NP_665810.1 PMP22_Claudin 18..195 CDD:389833 49/194 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144482
Domainoid 1 1.000 57 1.000 Domainoid score I10855
eggNOG 1 0.900 - - E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - otm41386
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12107
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5605
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.