DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stg1 and Cacng4

Sequence 1:NP_001027082.1 Gene:stg1 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_542423.1 Gene:Cacng4 RGDID:628804 Length:327 Species:Rattus norvegicus

Alignment Length:234 Identity:69/235 (29%)
Similarity:109/235 (46%) Gaps:42/235 (18%)


  Fly   217 MTTVNGGYLWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITK--- 278
            |...:.|...|:|...|..:.:::..|:....||::...:    .||| |. .:|||....:   
  Rat     1 MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHI----CNGT-NL-TMDDGPPPRRARG 59

  Fly   279 -YTKSSLWILCTTLPGLDADSY--NCVKIDYFSNEG-YQPDPHDSTAAIPYTVTKSCPIFLAAGV 339
             .|.|.||.:| .:.|:    |  :|.:|::|..:. |.   |||:..:       ..|..|:.|
  Rat    60 DLTHSGLWRVC-CIEGI----YKGHCFRINHFPEDNDYD---HDSSEYL-------LRIVRASSV 109

  Fly   340 FLVISFIVFLI-PTC-------SHQNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRP 396
            |.::|.|:.|: ..|       |.:||: ..||||||:.:||..:||:|.|||   :..|.....
  Rat   110 FPILSTILLLLGGLCIGAGRIYSRKNNI-VLSAGILFVAAGLSNIIGIIVYIS---SNTGDPSDK 170

  Fly   397 RSTLQPALIKVSYGQSFFLFVFGFIVTEFVGVLNIFLFI 435
            |.  :......:||.||:.....|||.|.||||.:.::|
  Rat   171 RD--EDKKNHYNYGWSFYFGALSFIVAETVGVLAVNIYI 207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 62/209 (30%)
Cacng4NP_542423.1 PMP22_Claudin 6..202 CDD:304458 67/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.