DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stg1 and cacng3

Sequence 1:NP_001027082.1 Gene:stg1 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_002932480.1 Gene:cacng3 XenbaseID:XB-GENE-1010716 Length:317 Species:Xenopus tropicalis

Alignment Length:220 Identity:65/221 (29%)
Similarity:95/221 (43%) Gaps:31/221 (14%)


  Fly   223 GYLWLITPVAASISVAIVIAALAGPQWLFTEEKLPNANYNGTANFKALDDGAYITK----YTKSS 283
            |...|||.|.|..:.:::..|:....||::         .|....|:.:|.....|    .|.|.
 Frog     7 GVQMLITTVGAFAAFSLMTIAVGTDYWLYS---------RGVCKAKSTNDNETSKKNEEVMTHSG 62

  Fly   284 LWILCTTLPGLDADSYNCVKIDYFSNEG-YQPDPHDSTAAIPYTVTKSCPIF--LAAGVFLVISF 345
            ||..| .|.|  |....|.|||:|..:. |:.|    ||.......::..||  |:.|:......
 Frog    63 LWRTC-CLEG--AFRGMCKKIDHFPEDADYEQD----TAEYLLRAVRASSIFPILSVGLLFFGGL 120

  Fly   346 IVFLIPTCSHQNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIKVSYG 410
            .|.......:::|: ..||||.|:.:||..:||:|.|||....:.|.....:|       ..|||
 Frog   121 CVAASEFYKNKHNV-ILSAGIFFVSAGLSNIIGIIVYISANAGDPGQSDSKKS-------NYSYG 177

  Fly   411 QSFFLFVFGFIVTEFVGVLNIFLFI 435
            .||:.....||:.|.||||.:.:||
 Frog   178 WSFYFGALSFIIAEMVGVLAVHMFI 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 56/201 (28%)
cacng3XP_002932480.1 PMP22_Claudin 6..197 CDD:250157 63/214 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000191
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.