DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment stg1 and cacng5b

DIOPT Version :9

Sequence 1:NP_001027082.1 Gene:stg1 / 318064 FlyBaseID:FBgn0064123 Length:447 Species:Drosophila melanogaster
Sequence 2:XP_002661320.1 Gene:cacng5b / 100331116 ZFINID:ZDB-GENE-120104-3 Length:275 Species:Danio rerio


Alignment Length:213 Identity:59/213 - (27%)
Similarity:97/213 - (45%) Gaps:22/213 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LWLITPVAASISVAIVIAALAGPQWLFTEEK--LPNANYNGTANFKALDDGAYITKYTKSSLWIL 287
            |.|::.|.|..|:.::..|::...||:.||.  ||            |:....|.....|.||.:
Zfish     9 LTLLSSVFAVCSLGLLGIAVSTDYWLYLEEGVILP------------LNQSTDIRMSIHSGLWRV 61

  Fly   288 CTTLPGLDADSYNCVKIDYFSNEGYQPDPHDSTAAIPYTVTKSCPIFLAAGVFLVISFIVFLIPT 352
            | .|.|  .:...|..|:|......|. ..:||.::...:..:.|..|.:..|:.|.|::..|..
Zfish    62 C-FLAG--EERGRCFTIEYVMPMSVQL-TSESTVSVLKMIRSATPFPLVSLFFMFIGFVLNNIGH 122

  Fly   353 CSHQNNLYYFSAGILFIVSGLVMLIGLIAYISILKAEIGSKLRPRSTLQPALIKVSYGQSFFLFV 417
            ......:..|.:||.||:|||.:::||:.|||    .|..::..|:....|.....||.||....
Zfish   123 IRPHRTILAFVSGIFFILSGLSLVVGLVLYIS----SINDEMFNRTKSNEAYFSYKYGWSFAFAA 183

  Fly   418 FGFIVTEFVGVLNIFLFI 435
            ..|::||..||::::||:
Zfish   184 ISFLLTESAGVMSVYLFM 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
stg1NP_001027082.1 PMP22_Claudin 235..429 CDD:304458 52/195 (27%)
cacng5bXP_002661320.1 PMP22_Claudin 9..195 CDD:304458 56/205 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577598
Domainoid 1 1.000 66 1.000 Domainoid score I9896
eggNOG 1 0.900 - - E1_28M76
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000345
OrthoInspector 1 1.000 - - otm24542
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12107
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.